SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30115.Seq
         (690 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC121794-1|AAI21795.1|  806|Homo sapiens valosin-containing prot...   131   3e-30
BC110913-1|AAI10914.1|  806|Homo sapiens valosin-containing prot...   131   3e-30
AL353795-2|CAH70993.1|  806|Homo sapiens valosin-containing prot...   131   3e-30
AF313485-1|AAG29873.1|  307|Homo sapiens valosin-containing prot...   131   3e-30
AF100752-1|AAD43016.1|  806|Homo sapiens transitional endoplasmi...   131   3e-30
AC004472-1|AAC07984.1|  806|Homo sapiens TERA_HUMAN protein.          131   3e-30
BC007562-1|AAH07562.2|  644|Homo sapiens VCP protein protein.         108   2e-23

>BC121794-1|AAI21795.1|  806|Homo sapiens valosin-containing protein
           protein.
          Length = 806

 Score =  131 bits (316), Expect = 3e-30
 Identities = 57/86 (66%), Positives = 66/86 (76%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD C DEKIRM             DV+SI PCP VKYGKR+H+LPIDD+VEG+TGNL
Sbjct: 71  VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNL 130

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRG 511
           FEVYLKPYF+EAYRPI + D F+VRG
Sbjct: 131 FEVYLKPYFLEAYRPIRKGDIFLVRG 156



 Score =  117 bits (281), Expect = 5e-26
 Identities = 51/57 (89%), Positives = 55/57 (96%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMRAVEFKVVET PSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 157 GMRAVEFKVVETHPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213



 Score =  106 bits (254), Expect = 9e-23
 Identities = 50/67 (74%), Positives = 63/67 (94%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 234 RKETVCI 254
           R+E VCI
Sbjct: 64  RREAVCI 70


>BC110913-1|AAI10914.1|  806|Homo sapiens valosin-containing protein
           protein.
          Length = 806

 Score =  131 bits (316), Expect = 3e-30
 Identities = 57/86 (66%), Positives = 66/86 (76%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD C DEKIRM             DV+SI PCP VKYGKR+H+LPIDD+VEG+TGNL
Sbjct: 71  VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNL 130

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRG 511
           FEVYLKPYF+EAYRPI + D F+VRG
Sbjct: 131 FEVYLKPYFLEAYRPIRKGDIFLVRG 156



 Score =  120 bits (288), Expect = 6e-27
 Identities = 52/57 (91%), Positives = 56/57 (98%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 157 GMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213



 Score =  106 bits (254), Expect = 9e-23
 Identities = 50/67 (74%), Positives = 63/67 (94%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 234 RKETVCI 254
           R+E VCI
Sbjct: 64  RREAVCI 70


>AL353795-2|CAH70993.1|  806|Homo sapiens valosin-containing protein
           protein.
          Length = 806

 Score =  131 bits (316), Expect = 3e-30
 Identities = 57/86 (66%), Positives = 66/86 (76%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD C DEKIRM             DV+SI PCP VKYGKR+H+LPIDD+VEG+TGNL
Sbjct: 71  VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNL 130

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRG 511
           FEVYLKPYF+EAYRPI + D F+VRG
Sbjct: 131 FEVYLKPYFLEAYRPIRKGDIFLVRG 156



 Score =  120 bits (288), Expect = 6e-27
 Identities = 52/57 (91%), Positives = 56/57 (98%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 157 GMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213



 Score =  106 bits (254), Expect = 9e-23
 Identities = 50/67 (74%), Positives = 63/67 (94%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 234 RKETVCI 254
           R+E VCI
Sbjct: 64  RREAVCI 70


>AF313485-1|AAG29873.1|  307|Homo sapiens valosin-containing protein
           protein.
          Length = 307

 Score =  131 bits (316), Expect = 3e-30
 Identities = 57/86 (66%), Positives = 66/86 (76%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD C DEKIRM             DV+SI PCP VKYGKR+H+LPIDD+VEG+TGNL
Sbjct: 9   VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNL 68

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRG 511
           FEVYLKPYF+EAYRPI + D F+VRG
Sbjct: 69  FEVYLKPYFLEAYRPIRKGDIFLVRG 94



 Score =  120 bits (288), Expect = 6e-27
 Identities = 52/57 (91%), Positives = 56/57 (98%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 95  GMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 151


>AF100752-1|AAD43016.1|  806|Homo sapiens transitional endoplasmic
           reticulum ATPase protein.
          Length = 806

 Score =  131 bits (316), Expect = 3e-30
 Identities = 57/86 (66%), Positives = 66/86 (76%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD C DEKIRM             DV+SI PCP VKYGKR+H+LPIDD+VEG+TGNL
Sbjct: 71  VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNL 130

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRG 511
           FEVYLKPYF+EAYRPI + D F+VRG
Sbjct: 131 FEVYLKPYFLEAYRPIRKGDIFLVRG 156



 Score =  120 bits (288), Expect = 6e-27
 Identities = 52/57 (91%), Positives = 56/57 (98%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 157 GMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213



 Score =  106 bits (254), Expect = 9e-23
 Identities = 50/67 (74%), Positives = 63/67 (94%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 234 RKETVCI 254
           R+E VCI
Sbjct: 64  RREAVCI 70


>AC004472-1|AAC07984.1|  806|Homo sapiens TERA_HUMAN protein.
          Length = 806

 Score =  131 bits (316), Expect = 3e-30
 Identities = 57/86 (66%), Positives = 66/86 (76%)
 Frame = +2

Query: 254 LLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHILPIDDSVEGLTGNL 433
           +LSDD C DEKIRM             DV+SI PCP VKYGKR+H+LPIDD+VEG+TGNL
Sbjct: 71  VLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNL 130

Query: 434 FEVYLKPYFMEAYRPIHRDDTFMVRG 511
           FEVYLKPYF+EAYRPI + D F+VRG
Sbjct: 131 FEVYLKPYFLEAYRPIRKGDIFLVRG 156



 Score =  120 bits (288), Expect = 6e-27
 Identities = 52/57 (91%), Positives = 56/57 (98%)
 Frame = +1

Query: 511 GMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           GMRAVEFKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 157 GMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 213



 Score =  106 bits (254), Expect = 9e-23
 Identities = 50/67 (74%), Positives = 63/67 (94%)
 Frame = +3

Query: 54  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 233
           AD+K  DDLSTAIL++K+RPNRLIV+EA+++DNSVV+LSQ KM++LQLFRGDTVLLKGK+
Sbjct: 5   ADSKG-DDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKK 63

Query: 234 RKETVCI 254
           R+E VCI
Sbjct: 64  RREAVCI 70


>BC007562-1|AAH07562.2|  644|Homo sapiens VCP protein protein.
          Length = 644

 Score =  108 bits (259), Expect = 2e-23
 Identities = 46/51 (90%), Positives = 50/51 (98%)
 Frame = +1

Query: 529 FKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 681
           FKVVETDPSP+CIVAPDTVIHC+GEPIKRE+EEE+LN VGYDDIGGCRKQL
Sbjct: 1   FKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQL 51


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,367,304
Number of Sequences: 237096
Number of extensions: 2119874
Number of successful extensions: 4617
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 4405
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4617
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7895240574
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -