SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30112.Seq
         (446 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC040704-1|AAH40704.1|  291|Homo sapiens C7orf27 protein protein.      29   7.2  
BC023561-1|AAH23561.2|  582|Homo sapiens C7orf27 protein protein.      29   7.2  
BC015632-1|AAH15632.2|  821|Homo sapiens chromosome 7 open readi...    29   7.2  
BC007209-1|AAH07209.1|  662|Homo sapiens C7orf27 protein protein.      29   7.2  
BX641140-1|CAE46062.1|  863|Homo sapiens hypothetical protein pr...    29   9.5  
BC113587-1|AAI13588.1|  972|Homo sapiens chromosome 12 open read...    29   9.5  
BC113585-1|AAI13586.1|  972|Homo sapiens chromosome 12 open read...    29   9.5  
BC093790-1|AAH93790.1|  577|Homo sapiens male-specific lethal 2-...    29   9.5  
BC093764-1|AAH93764.1|  577|Homo sapiens male-specific lethal 2-...    29   9.5  
BC034357-1|AAH34357.1|  875|Homo sapiens C12orf30 protein protein.     29   9.5  
AK025747-1|BAB15231.1|  171|Homo sapiens protein ( Homo sapiens ...    29   9.5  
AK023151-1|BAB14432.1|  852|Homo sapiens protein ( Homo sapiens ...    29   9.5  
AK001267-1|BAA91590.1|  639|Homo sapiens protein ( Homo sapiens ...    29   9.5  
AC093727-1|AAX81992.1|  639|Homo sapiens unknown protein.              29   9.5  
AB054990-1|BAC80174.1|  972|Homo sapiens P120 protein.                 29   9.5  
AB046805-1|BAB13411.1|  595|Homo sapiens KIAA1585 protein protein.     29   9.5  

>BC040704-1|AAH40704.1|  291|Homo sapiens C7orf27 protein protein.
          Length = 291

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/57 (26%), Positives = 25/57 (43%)
 Frame = -1

Query: 326 LKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSSGSDIRWTV 156
           L+LLHI  +D     R  + +     L  GH+  A D+   +     ++  D+ W V
Sbjct: 64  LELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEV 120


>BC023561-1|AAH23561.2|  582|Homo sapiens C7orf27 protein protein.
          Length = 582

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/57 (26%), Positives = 25/57 (43%)
 Frame = -1

Query: 326 LKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSSGSDIRWTV 156
           L+LLHI  +D     R  + +     L  GH+  A D+   +     ++  D+ W V
Sbjct: 355 LELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEV 411


>BC015632-1|AAH15632.2|  821|Homo sapiens chromosome 7 open reading
           frame 27 protein.
          Length = 821

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/57 (26%), Positives = 25/57 (43%)
 Frame = -1

Query: 326 LKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSSGSDIRWTV 156
           L+LLHI  +D     R  + +     L  GH+  A D+   +     ++  D+ W V
Sbjct: 594 LELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEV 650


>BC007209-1|AAH07209.1|  662|Homo sapiens C7orf27 protein protein.
          Length = 662

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/57 (26%), Positives = 25/57 (43%)
 Frame = -1

Query: 326 LKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLLRTESSSGSDIRWTV 156
           L+LLHI  +D     R  + +     L  GH+  A D+   +     ++  D+ W V
Sbjct: 435 LELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEV 491


>BX641140-1|CAE46062.1|  863|Homo sapiens hypothetical protein
           protein.
          Length = 863

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -1

Query: 299 DCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           +C++LSR +L + SD    Y   +T FDSVF L+
Sbjct: 251 ECNALSRRLLLKNSDDWQFY---LTYFDSVFRLI 281


>BC113587-1|AAI13588.1|  972|Homo sapiens chromosome 12 open reading
           frame 30 protein.
          Length = 972

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -1

Query: 299 DCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           +C++LSR +L + SD    Y   +T FDSVF L+
Sbjct: 247 ECNALSRRLLLKNSDDWQFY---LTYFDSVFRLI 277


>BC113585-1|AAI13586.1|  972|Homo sapiens chromosome 12 open reading
           frame 30 protein.
          Length = 972

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -1

Query: 299 DCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           +C++LSR +L + SD    Y   +T FDSVF L+
Sbjct: 247 ECNALSRRLLLKNSDDWQFY---LTYFDSVFRLI 277


>BC093790-1|AAH93790.1|  577|Homo sapiens male-specific lethal
           2-like 1 (Drosophila) protein.
          Length = 577

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = -1

Query: 377 ITVYCYTKIQQSFLRDSLKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           I V CY K+ +   + +L    I  +DCSS   +IL   +D  L    +    DS F L 
Sbjct: 98  ILVNCYKKLCEYITQTTLARDIIEAVDCSS---DILALLNDGSLFCEETEKPSDSSFTLC 154

Query: 197 RTES 186
            T S
Sbjct: 155 LTHS 158


>BC093764-1|AAH93764.1|  577|Homo sapiens male-specific lethal
           2-like 1 (Drosophila) protein.
          Length = 577

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = -1

Query: 377 ITVYCYTKIQQSFLRDSLKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           I V CY K+ +   + +L    I  +DCSS   +IL   +D  L    +    DS F L 
Sbjct: 98  ILVNCYKKLCEYITQTTLARDIIEAVDCSS---DILALLNDGSLFCEETEKPSDSSFTLC 154

Query: 197 RTES 186
            T S
Sbjct: 155 LTHS 158


>BC034357-1|AAH34357.1|  875|Homo sapiens C12orf30 protein protein.
          Length = 875

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -1

Query: 299 DCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           +C++LSR +L + SD    Y   +T FDSVF L+
Sbjct: 247 ECNALSRRLLLKNSDDWQFY---LTYFDSVFRLI 277


>AK025747-1|BAB15231.1|  171|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22094 fis, clone HEP16856. ).
          Length = 171

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = +1

Query: 181 ELDSVLSSKKTESNAVTECPXKRPES--EARRRMFLERLL 294
           +LD+VL+S   E   V  C   +PE   E+ RR F++RLL
Sbjct: 24  QLDTVLTS--AEDQIVVICATSKPEEIDESLRRYFMKRLL 61


>AK023151-1|BAB14432.1|  852|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13089 fis, clone NT2RP3002108, weakly similar to
           DEC1 PROTEIN. ).
          Length = 852

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -1

Query: 299 DCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           +C++LSR +L + SD    Y   +T FDSVF L+
Sbjct: 127 ECNALSRRLLLKNSDDWQFY---LTYFDSVFRLI 157


>AK001267-1|BAA91590.1|  639|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10405 fis, clone NT2RM4000496, weakly similar to
           SAP1 PROTEIN. ).
          Length = 639

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = +1

Query: 181 ELDSVLSSKKTESNAVTECPXKRPES--EARRRMFLERLL 294
           +LD+VL+S   E   V  C   +PE   E+ RR F++RLL
Sbjct: 492 QLDTVLTS--AEDQIVVICATSKPEEIDESLRRYFMKRLL 529


>AC093727-1|AAX81992.1|  639|Homo sapiens unknown protein.
          Length = 639

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = +1

Query: 181 ELDSVLSSKKTESNAVTECPXKRPES--EARRRMFLERLL 294
           +LD+VL+S   E   V  C   +PE   E+ RR F++RLL
Sbjct: 492 QLDTVLTS--AEDQIVVICATSKPEEIDESLRRYFMKRLL 529


>AB054990-1|BAC80174.1|  972|Homo sapiens P120 protein.
          Length = 972

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -1

Query: 299 DCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           +C++LSR +L + SD    Y   +T FDSVF L+
Sbjct: 247 ECNALSRRLLLKNSDDWQFY---LTYFDSVFRLI 277


>AB046805-1|BAB13411.1|  595|Homo sapiens KIAA1585 protein protein.
          Length = 595

 Score = 28.7 bits (61), Expect = 9.5
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = -1

Query: 377 ITVYCYTKIQQSFLRDSLKLLHISKIDCSSLSRNILRRASDSGLXYGHSVTAFDSVFLLL 198
           I V CY K+ +   + +L    I  +DCSS   +IL   +D  L    +    DS F L 
Sbjct: 116 ILVNCYKKLCEYITQTTLARDIIEAVDCSS---DILALLNDGSLFCEETEKPSDSSFTLC 172

Query: 197 RTES 186
            T S
Sbjct: 173 LTHS 176


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 57,314,452
Number of Sequences: 237096
Number of extensions: 1190422
Number of successful extensions: 2851
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 2766
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2851
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 3644351872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -