SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30111.Seq
         (593 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X52882-1|CAA37064.1|  556|Homo sapiens t-complex polypeptide 1 p...   144   2e-34
BT006969-1|AAP35615.1|  556|Homo sapiens t-complex 1 protein.         144   2e-34
BC000665-1|AAH00665.1|  556|Homo sapiens t-complex 1 protein.         144   2e-34
AL135914-7|CAI21851.1|  556|Homo sapiens t-complex 1 protein.         144   2e-34
U91327-1|AAB67249.1|  217|Homo sapiens T-complex protein 1, Beta...    89   1e-17
BT019966-1|AAV38769.1|  535|Homo sapiens chaperonin containing T...    89   1e-17
BC113516-1|AAI13517.1|  535|Homo sapiens chaperonin containing T...    89   1e-17
BC113514-1|AAI13515.1|  535|Homo sapiens chaperonin containing T...    89   1e-17
AF026293-1|AAC96012.1|  535|Homo sapiens chaperonin containing t...    89   1e-17
AF026166-1|AAC98906.1|  535|Homo sapiens chaperonin-containing T...    89   1e-17
CR457071-1|CAG33352.1|  535|Homo sapiens CCT2 protein.                 87   4e-17
X74801-1|CAA52808.1|  544|Homo sapiens gamma subunit of CCT chap...    81   3e-15
BC008019-1|AAH08019.1|  544|Homo sapiens chaperonin containing T...    81   3e-15
BC006501-1|AAH06501.3|  545|Homo sapiens chaperonin containing T...    81   3e-15
AY524046-1|AAS94255.1|  545|Homo sapiens PIG48 protein.                81   3e-15
AL589685-15|CAI14173.1|  188|Homo sapiens chaperonin containing ...    81   3e-15
AL589685-14|CAI14172.1|  276|Homo sapiens chaperonin containing ...    81   3e-15
AL589685-10|CAI14167.1|  545|Homo sapiens chaperonin containing ...    81   3e-15
AB208882-1|BAD92119.1|  577|Homo sapiens chaperonin containing T...    81   3e-15
U83843-1|AAB41437.1|  412|Homo sapiens HIV-1 Nef interacting pro...    76   8e-14
CR536511-1|CAG38749.1|  543|Homo sapiens CCT7 protein.                 76   8e-14
BC088351-1|AAH88351.1|  543|Homo sapiens chaperonin containing T...    76   8e-14
BC019296-1|AAH19296.1|  543|Homo sapiens chaperonin containing T...    76   8e-14
AK222478-1|BAD96198.1|  543|Homo sapiens chaperonin containing T...    76   8e-14
AF026292-1|AAC96011.1|  543|Homo sapiens chaperonin containing t...    76   8e-14
AC010913-3|AAX88902.1|  543|Homo sapiens unknown protein.              76   8e-14
U38846-1|AAC50384.1|  539|Homo sapiens stimulator of TAR RNA bin...    75   3e-13
BC106934-1|AAI06935.1|  539|Homo sapiens chaperonin containing T...    75   3e-13
BC106933-1|AAI06934.1|  539|Homo sapiens chaperonin containing T...    75   3e-13
AF026291-1|AAC96010.1|  539|Homo sapiens chaperonin containing t...    75   3e-13
AC107081-1|AAY24140.1|  539|Homo sapiens unknown protein.              75   3e-13
CR456719-1|CAG33000.1|  543|Homo sapiens CCT7 protein.                 74   4e-13
D43950-1|BAA07894.2|  553|Homo sapiens KIAA0098 protein protein.       73   8e-13
BC035499-1|AAH35499.1|  541|Homo sapiens chaperonin containing T...    73   8e-13
BC006543-1|AAH06543.1|  541|Homo sapiens chaperonin containing T...    73   8e-13
BC002971-1|AAH02971.1|  539|Homo sapiens Unknown (protein for IM...    73   8e-13
D42052-1|BAA07652.1|  539|Homo sapiens KIAA0002 protein.               71   3e-12
D13627-1|BAA02792.2|  555|Homo sapiens KIAA0002 protein.               71   3e-12
BC095470-1|AAH95470.1|  548|Homo sapiens chaperonin containing T...    71   3e-12
BC072001-1|AAH72001.1|  548|Homo sapiens chaperonin containing T...    71   3e-12
BC012584-1|AAH12584.1|  497|Homo sapiens CCT8 protein protein.         71   3e-12
AL163249-4|CAB90433.1|  548|Homo sapiens T-complex protein 1 the...    71   3e-12
AK222490-1|BAD96210.1|  548|Homo sapiens chaperonin containing T...    71   3e-12
L27706-1|AAA61061.1|  531|Homo sapiens chaperonin-like protein p...    64   3e-10
BC106942-1|AAI06943.1|  531|Homo sapiens chaperonin containing T...    64   3e-10
AM295155-1|CAL26601.1|  488|Homo sapiens chaperonin subunit 6A p...    64   3e-10
AF385084-1|AAK61354.1|  531|Homo sapiens heat shock protein prot...    64   3e-10
AB209728-1|BAD92965.1|  529|Homo sapiens chaperonin containing T...    64   3e-10
AB063318-1|BAB61032.1|  531|Homo sapiens acute morphine dependen...    64   3e-10
BC027591-1|AAH27591.1|  530|Homo sapiens chaperonin containing T...    62   1e-09
BC026125-1|AAH26125.1|  530|Homo sapiens chaperonin containing T...    62   1e-09
D78333-1|BAA11347.1|  540|Homo sapiens testis-specific TCP20 pro...    59   1e-08
AL589685-11|CAI14169.1|  161|Homo sapiens chaperonin containing ...    59   1e-08
AL589685-9|CAI14168.1|  522|Homo sapiens chaperonin containing T...    55   2e-07
AL589685-12|CAI14170.1|  168|Homo sapiens chaperonin containing ...    54   4e-07
CR456508-1|CAG30394.1|  557|Homo sapiens KCNMB3L protein.              52   2e-06
BC139842-1|AAI39843.2|  562|Homo sapiens CESK1 protein protein.        52   2e-06
BC100813-1|AAI00814.1|  557|Homo sapiens chaperonin containing T...    52   2e-06
BC100812-1|AAI00813.1|  557|Homo sapiens chaperonin containing T...    52   2e-06
BC100811-1|AAI00812.1|  557|Homo sapiens chaperonin containing T...    52   2e-06
BC033797-1|AAH33797.1|  557|Homo sapiens chaperonin containing T...    52   2e-06
AP003553-1|BAB43952.1|  557|Homo sapiens T-complex protein 1 pro...    52   2e-06
AP000365-1|BAA84680.1|  557|Homo sapiens hypothetical protein pr...    52   2e-06
M34664-1|AAA36022.1|  573|Homo sapiens protein ( Human chaperoni...    39   0.012
M22382-1|AAA60127.1|  573|Homo sapiens mitochondrial matrix prot...    39   0.012
DQ217936-1|ABB01006.1|  575|Homo sapiens heat shock protein 60 p...    39   0.012
BC073746-1|AAH73746.1|  573|Homo sapiens heat shock 60kDa protei...    39   0.012
BC067082-1|AAH67082.1|  573|Homo sapiens heat shock 60kDa protei...    39   0.012
BC003030-1|AAH03030.1|  573|Homo sapiens heat shock 60kDa protei...    39   0.012
BC002676-1|AAH02676.1|  573|Homo sapiens heat shock 60kDa protei...    39   0.012
AJ250915-2|CAB75426.1|  573|Homo sapiens chaperonin 60, Hsp60 pr...    39   0.012
AC020550-4|AAX93145.1|  233|Homo sapiens unknown protein.              39   0.012
X14830-1|CAA32939.1|  501|Homo sapiens protein ( Human mRNA for ...    32   1.8  
BC023553-1|AAH23553.1|  501|Homo sapiens cholinergic receptor, n...    32   1.8  
BC011371-1|AAH11371.1|  501|Homo sapiens cholinergic receptor, n...    32   1.8  
BC026355-1|AAH26355.2|  723|Homo sapiens Bardet-Biedl syndrome 1...    31   4.1  

>X52882-1|CAA37064.1|  556|Homo sapiens t-complex polypeptide 1
           protein.
          Length = 556

 Score =  144 bits (350), Expect = 2e-34
 Identities = 71/92 (77%), Positives = 78/92 (84%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPAAKVL ELA LQD+EVGDGTTSVVIIAAELLKNADELVK KIHPTS+ISGY
Sbjct: 62  LKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGY 121

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLACKEAV+YI +NL V  + LGR  LI   K
Sbjct: 122 RLACKEAVRYINENLIVNTDELGRDCLINAAK 153



 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/61 (73%), Positives = 51/61 (83%)
 Frame = +3

Query: 72  PLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           PLSV G RS G+ +R+QNVM      NIVKSSLGPVGLDKMLVDDIGDVT+TN+GATILK
Sbjct: 4   PLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILK 63

Query: 252 M 254
           +
Sbjct: 64  L 64



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDA 585
           + AKT+MSSK+IG + DFF+ MVVDA
Sbjct: 150 NAAKTSMSSKIIGINGDFFANMVVDA 175


>BT006969-1|AAP35615.1|  556|Homo sapiens t-complex 1 protein.
          Length = 556

 Score =  144 bits (350), Expect = 2e-34
 Identities = 71/92 (77%), Positives = 78/92 (84%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPAAKVL ELA LQD+EVGDGTTSVVIIAAELLKNADELVK KIHPTS+ISGY
Sbjct: 62  LKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGY 121

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLACKEAV+YI +NL V  + LGR  LI   K
Sbjct: 122 RLACKEAVRYINENLIVNTDELGRDCLINAAK 153



 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/61 (73%), Positives = 51/61 (83%)
 Frame = +3

Query: 72  PLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           PLSV G RS G+ +R+QNVM      NIVKSSLGPVGLDKMLVDDIGDVT+TN+GATILK
Sbjct: 4   PLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILK 63

Query: 252 M 254
           +
Sbjct: 64  L 64



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDA 585
           + AKT+MSSK+IG + DFF+ MVVDA
Sbjct: 150 NAAKTSMSSKIIGINGDFFANMVVDA 175


>BC000665-1|AAH00665.1|  556|Homo sapiens t-complex 1 protein.
          Length = 556

 Score =  144 bits (350), Expect = 2e-34
 Identities = 71/92 (77%), Positives = 78/92 (84%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPAAKVL ELA LQD+EVGDGTTSVVIIAAELLKNADELVK KIHPTS+ISGY
Sbjct: 62  LKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGY 121

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLACKEAV+YI +NL V  + LGR  LI   K
Sbjct: 122 RLACKEAVRYINENLIVNTDELGRDCLINAAK 153



 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/61 (73%), Positives = 51/61 (83%)
 Frame = +3

Query: 72  PLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           PLSV G RS G+ +R+QNVM      NIVKSSLGPVGLDKMLVDDIGDVT+TN+GATILK
Sbjct: 4   PLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILK 63

Query: 252 M 254
           +
Sbjct: 64  L 64



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDA 585
           + AKT+MSSK+IG + DFF+ MVVDA
Sbjct: 150 NAAKTSMSSKIIGINGDFFANMVVDA 175


>AL135914-7|CAI21851.1|  556|Homo sapiens t-complex 1 protein.
          Length = 556

 Score =  144 bits (350), Expect = 2e-34
 Identities = 71/92 (77%), Positives = 78/92 (84%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K +EVEHPAAKVL ELA LQD+EVGDGTTSVVIIAAELLKNADELVK KIHPTS+ISGY
Sbjct: 62  LKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGY 121

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLITQPK 520
           RLACKEAV+YI +NL V  + LGR  LI   K
Sbjct: 122 RLACKEAVRYINENLIVNTDELGRDCLINAAK 153



 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/61 (73%), Positives = 51/61 (83%)
 Frame = +3

Query: 72  PLSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           PLSV G RS G+ +R+QNVM      NIVKSSLGPVGLDKMLVDDIGDVT+TN+GATILK
Sbjct: 4   PLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILK 63

Query: 252 M 254
           +
Sbjct: 64  L 64



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = +1

Query: 508 HTAKTTMSSKLIGADADFFSEMVVDA 585
           + AKT+MSSK+IG + DFF+ MVVDA
Sbjct: 150 NAAKTSMSSKIIGINGDFFANMVVDA 175


>U91327-1|AAB67249.1|  217|Homo sapiens T-complex protein 1, Beta
           subunit (TCP-1-BETA) protein.
          Length = 217

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 39/67 (58%), Positives = 57/67 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ V++PAAKVLV+++++QD+EVGDGTTSV ++AAELL+ A+ L+  KIHP +II+G+
Sbjct: 71  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGW 130

Query: 425 RLACKEA 445
           R A K A
Sbjct: 131 REATKAA 137



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVT--VTNEGATILK 251
           ++VKS+LGP G+DK+L+    D +  VTN+GATILK
Sbjct: 37  DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILK 72


>BT019966-1|AAV38769.1|  535|Homo sapiens chaperonin containing
           TCP1, subunit 2 (beta) protein.
          Length = 535

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 39/67 (58%), Positives = 57/67 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ V++PAAKVLV+++++QD+EVGDGTTSV ++AAELL+ A+ L+  KIHP +II+G+
Sbjct: 71  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGW 130

Query: 425 RLACKEA 445
           R A K A
Sbjct: 131 REATKAA 137



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVT--VTNEGATILK 251
           ++VKS+LGP G+DK+L+    D +  VTN+GATILK
Sbjct: 37  DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILK 72


>BC113516-1|AAI13517.1|  535|Homo sapiens chaperonin containing
           TCP1, subunit 2 (beta) protein.
          Length = 535

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 39/67 (58%), Positives = 57/67 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ V++PAAKVLV+++++QD+EVGDGTTSV ++AAELL+ A+ L+  KIHP +II+G+
Sbjct: 71  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGW 130

Query: 425 RLACKEA 445
           R A K A
Sbjct: 131 REATKAA 137



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVT--VTNEGATILK 251
           ++VKS+LGP G+DK+L+    D +  VTN+GATILK
Sbjct: 37  DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILK 72


>BC113514-1|AAI13515.1|  535|Homo sapiens chaperonin containing
           TCP1, subunit 2 (beta) protein.
          Length = 535

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 39/67 (58%), Positives = 57/67 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ V++PAAKVLV+++++QD+EVGDGTTSV ++AAELL+ A+ L+  KIHP +II+G+
Sbjct: 71  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGW 130

Query: 425 RLACKEA 445
           R A K A
Sbjct: 131 REATKAA 137



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVT--VTNEGATILK 251
           ++VKS+LGP G+DK+L+    D +  VTN+GATILK
Sbjct: 37  DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILK 72


>AF026293-1|AAC96012.1|  535|Homo sapiens chaperonin containing
           t-complex polypeptide 1, beta subunit protein.
          Length = 535

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 39/67 (58%), Positives = 57/67 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ V++PAAKVLV+++++QD+EVGDGTTSV ++AAELL+ A+ L+  KIHP +II+G+
Sbjct: 71  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGW 130

Query: 425 RLACKEA 445
           R A K A
Sbjct: 131 REATKAA 137



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVT--VTNEGATILK 251
           ++VKS+LGP G+DK+L+    D +  VTN+GATILK
Sbjct: 37  DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILK 72


>AF026166-1|AAC98906.1|  535|Homo sapiens chaperonin-containing
           TCP-1 beta subunit homolog protein.
          Length = 535

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 39/67 (58%), Positives = 57/67 (85%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ V++PAAKVLV+++++QD+EVGDGTTSV ++AAELL+ A+ L+  KIHP +II+G+
Sbjct: 71  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGW 130

Query: 425 RLACKEA 445
           R A K A
Sbjct: 131 REATKAA 137



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVT--VTNEGATILK 251
           ++VKS+LGP G+DK+L+    D +  VTN+GATILK
Sbjct: 37  DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILK 72


>CR457071-1|CAG33352.1|  535|Homo sapiens CCT2 protein.
          Length = 535

 Score = 87.0 bits (206), Expect = 4e-17
 Identities = 38/67 (56%), Positives = 56/67 (83%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +KN+ V++PAAKVLV+++++QD+EVGDGTTSV ++AAELL+ A+ L+  KIHP + I+G+
Sbjct: 71  LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTTIAGW 130

Query: 425 RLACKEA 445
           R A K A
Sbjct: 131 REATKAA 137



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 20/36 (55%), Positives = 28/36 (77%), Gaps = 2/36 (5%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVT--VTNEGATILK 251
           ++VKS+LGP G+DK+L+    D +  VTN+GATILK
Sbjct: 37  DLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILK 72


>X74801-1|CAA52808.1|  544|Homo sapiens gamma subunit of CCT
           chaperonin protein.
          Length = 544

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 32/72 (44%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS Y
Sbjct: 66  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAY 125

Query: 425 RLACKEAVKYIQ 460
           R A  + +  ++
Sbjct: 126 RKALDDMISTLK 137



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 9   LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 67


>BC008019-1|AAH08019.1|  544|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) protein.
          Length = 544

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 32/72 (44%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS Y
Sbjct: 66  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAY 125

Query: 425 RLACKEAVKYIQ 460
           R A  + +  ++
Sbjct: 126 RKALDDMISTLK 137



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 9   LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 67


>BC006501-1|AAH06501.3|  545|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) protein.
          Length = 545

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 32/72 (44%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS Y
Sbjct: 67  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAY 126

Query: 425 RLACKEAVKYIQ 460
           R A  + +  ++
Sbjct: 127 RKALDDMISTLK 138



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 10  LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 68


>AY524046-1|AAS94255.1|  545|Homo sapiens PIG48 protein.
          Length = 545

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 32/72 (44%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS Y
Sbjct: 67  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAY 126

Query: 425 RLACKEAVKYIQ 460
           R A  + +  ++
Sbjct: 127 RKALDDMISTLK 138



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 20/59 (33%), Positives = 33/59 (55%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G   +TN+G  IL+
Sbjct: 10  LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGNVMTNDGNAILR 68


>AL589685-15|CAI14173.1|  188|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) protein.
          Length = 188

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 33/73 (45%), Positives = 54/73 (73%)
 Frame = +2

Query: 242 NIKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISG 421
           N   ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS 
Sbjct: 52  NAAKIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISA 111

Query: 422 YRLACKEAVKYIQ 460
           YR A  + +  ++
Sbjct: 112 YRKALDDMISTLK 124


>AL589685-14|CAI14172.1|  276|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) protein.
          Length = 276

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 32/72 (44%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS Y
Sbjct: 91  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAY 150

Query: 425 RLACKEAVKYIQ 460
           R A  + +  ++
Sbjct: 151 RKALDDMISTLK 162



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = +3

Query: 93  RSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 40  RESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 92


>AL589685-10|CAI14167.1|  545|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) protein.
          Length = 545

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 32/72 (44%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS Y
Sbjct: 67  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAY 126

Query: 425 RLACKEAVKYIQ 460
           R A  + +  ++
Sbjct: 127 RKALDDMISTLK 138



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 10  LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 68


>AB208882-1|BAD92119.1|  577|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) variant protein.
          Length = 577

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 32/72 (44%), Positives = 55/72 (76%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+A E+L  A+  ++ ++HPT +IS Y
Sbjct: 99  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAY 158

Query: 425 RLACKEAVKYIQ 460
           R A  + +  ++
Sbjct: 159 RKALDDMISTLK 170



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 42  LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 100


>U83843-1|AAB41437.1|  412|Homo sapiens HIV-1 Nef interacting
           protein protein.
          Length = 412

 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 54  LKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 113

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 114 RTATQLAVNKIKE-IAVTVK 132



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 4   SQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 56



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 481 RVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +V  + + +  A T +SSKLI     FF++MVVDA
Sbjct: 136 KVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA 170


>CR536511-1|CAG38749.1|  543|Homo sapiens CCT7 protein.
          Length = 543

 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 66  LKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 125

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 126 RTATQLAVNKIKE-IAVTVK 144



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 16  SQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 481 RVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +V  + + +  A T +SSKLI     FF++MVVDA
Sbjct: 148 KVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA 182


>BC088351-1|AAH88351.1|  543|Homo sapiens chaperonin containing
           TCP1, subunit 7 (eta) protein.
          Length = 543

 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 66  LKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 125

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 126 RTATQLAVNKIKE-IAVTVK 144



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 16  SQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 481 RVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +V  + + +  A T +SSKLI     FF++MVVDA
Sbjct: 148 KVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA 182


>BC019296-1|AAH19296.1|  543|Homo sapiens chaperonin containing
           TCP1, subunit 7 (eta) protein.
          Length = 543

 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 66  LKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 125

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 126 RTATQLAVNKIKE-IAVTVK 144



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 16  SQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 481 RVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +V  + + +  A T +SSKLI     FF++MVVDA
Sbjct: 148 KVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA 182


>AK222478-1|BAD96198.1|  543|Homo sapiens chaperonin containing
           TCP1, subunit 7 (eta) variant protein.
          Length = 543

 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 66  LKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 125

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 126 RTATQLAVNKIKE-IAVTVK 144



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 16  SQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 481 RVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +V  + + +  A T +SSKLI     FF++MVVDA
Sbjct: 148 KVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA 182


>AF026292-1|AAC96011.1|  543|Homo sapiens chaperonin containing
           t-complex polypeptide 1, eta subunit protein.
          Length = 543

 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 66  LKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 125

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 126 RTATQLAVNKIKE-IAVTVK 144



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 16  SQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 481 RVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +V  + + +  A T +SSKLI     FF++MVVDA
Sbjct: 148 KVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA 182


>AC010913-3|AAX88902.1|  543|Homo sapiens unknown protein.
          Length = 543

 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 39/80 (48%), Positives = 55/80 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK LV++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 66  LKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 125

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 126 RTATQLAVNKIKE-IAVTVK 144



 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 16  SQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 481 RVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +V  + + +  A T +SSKLI     FF++MVVDA
Sbjct: 148 KVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA 182


>U38846-1|AAC50384.1|  539|Homo sapiens stimulator of TAR RNA
           binding protein.
          Length = 539

 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAA++LVEL++ QD E GDGTTSVVIIA  LL +  +L++  IHPT I   +
Sbjct: 78  LKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESF 137

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A ++ ++ + D ++  VE   R +L+
Sbjct: 138 QKALEKGIEILTD-MSRPVELSDRETLL 164



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 23/47 (48%), Positives = 33/47 (70%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +R  N+       + +++SLGP G+DKM+ D  GDVT+TN+GATILK
Sbjct: 33  IRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILK 79


>BC106934-1|AAI06935.1|  539|Homo sapiens chaperonin containing
           TCP1, subunit 4 (delta) protein.
          Length = 539

 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAA++LVEL++ QD E GDGTTSVVIIA  LL +  +L++  IHPT I   +
Sbjct: 78  LKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESF 137

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A ++ ++ + D ++  VE   R +L+
Sbjct: 138 QKALEKGIEILTD-MSRPVELSDRETLL 164



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 23/47 (48%), Positives = 33/47 (70%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +R  N+       + +++SLGP G+DKM+ D  GDVT+TN+GATILK
Sbjct: 33  IRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILK 79


>BC106933-1|AAI06934.1|  539|Homo sapiens chaperonin containing
           TCP1, subunit 4 (delta) protein.
          Length = 539

 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAA++LVEL++ QD E GDGTTSVVIIA  LL +  +L++  IHPT I   +
Sbjct: 78  LKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESF 137

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A ++ ++ + D ++  VE   R +L+
Sbjct: 138 QKALEKGIEILTD-MSRPVELSDRETLL 164



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 23/47 (48%), Positives = 33/47 (70%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +R  N+       + +++SLGP G+DKM+ D  GDVT+TN+GATILK
Sbjct: 33  IRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILK 79


>AF026291-1|AAC96010.1|  539|Homo sapiens chaperonin containing
           t-complex polypeptide 1, delta subunit protein.
          Length = 539

 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAA++LVEL++ QD E GDGTTSVVIIA  LL +  +L++  IHPT I   +
Sbjct: 78  LKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESF 137

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A ++ ++ + D ++  VE   R +L+
Sbjct: 138 QKALEKGIEILTD-MSRPVELSDRETLL 164



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 23/47 (48%), Positives = 33/47 (70%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +R  N+       + +++SLGP G+DKM+ D  GDVT+TN+GATILK
Sbjct: 33  IRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILK 79


>AC107081-1|AAY24140.1|  539|Homo sapiens unknown protein.
          Length = 539

 Score = 74.5 bits (175), Expect = 3e-13
 Identities = 38/88 (43%), Positives = 60/88 (68%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAA++LVEL++ QD E GDGTTSVVIIA  LL +  +L++  IHPT I   +
Sbjct: 78  LKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESF 137

Query: 425 RLACKEAVKYIQDNLTVTVESLGRPSLI 508
           + A ++ ++ + D ++  VE   R +L+
Sbjct: 138 QKALEKGIEILTD-MSRPVELSDRETLL 164



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 23/47 (48%), Positives = 33/47 (70%)
 Frame = +3

Query: 111 VRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +R  N+       + +++SLGP G+DKM+ D  GDVT+TN+GATILK
Sbjct: 33  IRFSNISAAKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILK 79


>CR456719-1|CAG33000.1|  543|Homo sapiens CCT7 protein.
          Length = 543

 Score = 73.7 bits (173), Expect = 4e-13
 Identities = 38/80 (47%), Positives = 54/80 (67%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +K ++V HPAAK  V++A+ QD EVGDGTTSV ++AAE LK     V+  +HP  II  +
Sbjct: 66  LKLLDVVHPAAKTSVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAF 125

Query: 425 RLACKEAVKYIQDNLTVTVE 484
           R A + AV  I++ + VTV+
Sbjct: 126 RTATQLAVNKIKE-IAVTVK 144



 Score = 49.6 bits (113), Expect = 8e-06
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = +3

Query: 96  SCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           S G P    N+         V+++LGP G+DK++VD  G  T++N+GATILK+
Sbjct: 16  SQGTPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISNDGATILKL 68



 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 481 RVTWQAVSDHTAKTTMSSKLIGADADFFSEMVVDA 585
           +V  + + +  A T +SSKLI     FF++MVVDA
Sbjct: 148 KVEQRKLLEKCAMTALSSKLISQQKAFFAKMVVDA 182


>D43950-1|BAA07894.2|  553|Homo sapiens KIAA0098 protein protein.
          Length = 553

 Score = 72.9 bits (171), Expect = 8e-13
 Identities = 33/80 (41%), Positives = 56/80 (70%), Gaps = 3/80 (3%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++V+H  AK++VEL++ QD+E+GDGTT VV++A  LL+ A++L+   IHP  I  GY  A
Sbjct: 93  MDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA 152

Query: 434 CKEAVKY---IQDNLTVTVE 484
            + A+++   I D++ V ++
Sbjct: 153 ARVAIEHLDKISDSVLVDIK 172



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           +R  G      ++M      N +++SLGP GLDKM+VD  GDVTVTN+GATIL M
Sbjct: 38  SRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSM 92


>BC035499-1|AAH35499.1|  541|Homo sapiens chaperonin containing
           TCP1, subunit 5 (epsilon) protein.
          Length = 541

 Score = 72.9 bits (171), Expect = 8e-13
 Identities = 33/80 (41%), Positives = 56/80 (70%), Gaps = 3/80 (3%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++V+H  AK++VEL++ QD+E+GDGTT VV++A  LL+ A++L+   IHP  I  GY  A
Sbjct: 81  MDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA 140

Query: 434 CKEAVKY---IQDNLTVTVE 484
            + A+++   I D++ V ++
Sbjct: 141 ARVAIEHLDKISDSVLVDIK 160



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           +R  G      ++M      N +++SLGP GLDKM+VD  GDVTVTN+GATIL M
Sbjct: 26  SRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSM 80


>BC006543-1|AAH06543.1|  541|Homo sapiens chaperonin containing
           TCP1, subunit 5 (epsilon) protein.
          Length = 541

 Score = 72.9 bits (171), Expect = 8e-13
 Identities = 33/80 (41%), Positives = 56/80 (70%), Gaps = 3/80 (3%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++V+H  AK++VEL++ QD+E+GDGTT VV++A  LL+ A++L+   IHP  I  GY  A
Sbjct: 81  MDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA 140

Query: 434 CKEAVKY---IQDNLTVTVE 484
            + A+++   I D++ V ++
Sbjct: 141 ARVAIEHLDKISDSVLVDIK 160



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           +R  G      ++M      N +++SLGP GLDKM+VD  GDVTVTN+GATIL M
Sbjct: 26  SRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSM 80


>BC002971-1|AAH02971.1|  539|Homo sapiens Unknown (protein for
           IMAGE:3543711) protein.
          Length = 539

 Score = 72.9 bits (171), Expect = 8e-13
 Identities = 33/80 (41%), Positives = 56/80 (70%), Gaps = 3/80 (3%)
 Frame = +2

Query: 254 VEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLA 433
           ++V+H  AK++VEL++ QD+E+GDGTT VV++A  LL+ A++L+   IHP  I  GY  A
Sbjct: 79  MDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQA 138

Query: 434 CKEAVKY---IQDNLTVTVE 484
            + A+++   I D++ V ++
Sbjct: 139 ARVAIEHLDKISDSVLVDIK 158



 Score = 56.8 bits (131), Expect = 5e-08
 Identities = 28/55 (50%), Positives = 36/55 (65%)
 Frame = +3

Query: 90  TRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILKM 254
           +R  G      ++M      N +++SLGP GLDKM+VD  GDVTVTN+GATIL M
Sbjct: 24  SRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGATILSM 78


>D42052-1|BAA07652.1|  539|Homo sapiens KIAA0002 protein.
          Length = 539

 Score = 70.9 bits (166), Expect = 3e-12
 Identities = 29/82 (35%), Positives = 58/82 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  + +Q++EVGDGT  V++ A  LL+ A+EL++  +  + +I GY
Sbjct: 73  LRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGY 132

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +AC++A + + + +  + ++L
Sbjct: 133 EIACRKAHEILPNLVCCSAKNL 154



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+          +++ GP G++KM+++ +  + VTN+ ATIL+
Sbjct: 31  RNIQACKELAQTTRTAYGPKGMNKMVINHLEKLFVTNDAATILR 74


>D13627-1|BAA02792.2|  555|Homo sapiens KIAA0002 protein.
          Length = 555

 Score = 70.9 bits (166), Expect = 3e-12
 Identities = 29/82 (35%), Positives = 58/82 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  + +Q++EVGDGT  V++ A  LL+ A+EL++  +  + +I GY
Sbjct: 80  LRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGY 139

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +AC++A + + + +  + ++L
Sbjct: 140 EIACRKAHEILPNLVCCSAKNL 161



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+          +++ GP G++KM+++ +  + VTN+ ATIL+
Sbjct: 38  RNIQACKELAQTTRTAYGPKGMNKMVINHLEKLFVTNDAATILR 81


>BC095470-1|AAH95470.1|  548|Homo sapiens chaperonin containing
           TCP1, subunit 8 (theta) protein.
          Length = 548

 Score = 70.9 bits (166), Expect = 3e-12
 Identities = 29/82 (35%), Positives = 58/82 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  + +Q++EVGDGT  V++ A  LL+ A+EL++  +  + +I GY
Sbjct: 73  LRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGY 132

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +AC++A + + + +  + ++L
Sbjct: 133 EIACRKAHEILPNLVCCSAKNL 154



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+          +++ GP G++KM+++ +  + VTN+ ATIL+
Sbjct: 31  RNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILR 74


>BC072001-1|AAH72001.1|  548|Homo sapiens chaperonin containing
           TCP1, subunit 8 (theta) protein.
          Length = 548

 Score = 70.9 bits (166), Expect = 3e-12
 Identities = 29/82 (35%), Positives = 58/82 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  + +Q++EVGDGT  V++ A  LL+ A+EL++  +  + +I GY
Sbjct: 73  LRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGY 132

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +AC++A + + + +  + ++L
Sbjct: 133 EIACRKAHEILPNLVCCSAKNL 154



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+          +++ GP G++KM+++ +  + VTN+ ATIL+
Sbjct: 31  RNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILR 74


>BC012584-1|AAH12584.1|  497|Homo sapiens CCT8 protein protein.
          Length = 497

 Score = 70.9 bits (166), Expect = 3e-12
 Identities = 29/82 (35%), Positives = 58/82 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  + +Q++EVGDGT  V++ A  LL+ A+EL++  +  + +I GY
Sbjct: 22  LRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGY 81

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +AC++A + + + +  + ++L
Sbjct: 82  EIACRKAHEILPNLVCCSAKNL 103


>AL163249-4|CAB90433.1|  548|Homo sapiens T-complex protein 1 theta
           subunit protein.
          Length = 548

 Score = 70.9 bits (166), Expect = 3e-12
 Identities = 29/82 (35%), Positives = 58/82 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  + +Q++EVGDGT  V++ A  LL+ A+EL++  +  + +I GY
Sbjct: 73  LRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGY 132

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +AC++A + + + +  + ++L
Sbjct: 133 EIACRKAHEILPNLVCCSAKNL 154



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+          +++ GP G++KM+++ +  + VTN+ ATIL+
Sbjct: 31  RNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILR 74


>AK222490-1|BAD96210.1|  548|Homo sapiens chaperonin containing
           TCP1, subunit 8 (theta) variant protein.
          Length = 548

 Score = 70.9 bits (166), Expect = 3e-12
 Identities = 29/82 (35%), Positives = 58/82 (70%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +EV+HPAAK++V  + +Q++EVGDGT  V++ A  LL+ A+EL++  +  + +I GY
Sbjct: 73  LRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVSEVIEGY 132

Query: 425 RLACKEAVKYIQDNLTVTVESL 490
            +AC++A + + + +  + ++L
Sbjct: 133 EIACRKAHEILPNLVCCSAKNL 154



 Score = 33.5 bits (73), Expect = 0.58
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +3

Query: 120 QNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           +N+          +++ GP G++KM+++ +  + VTN+ ATIL+
Sbjct: 31  RNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILR 74


>L27706-1|AAA61061.1|  531|Homo sapiens chaperonin-like protein
           protein.
          Length = 531

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 26/73 (35%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 64  LHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGF 123

Query: 425 RLACKEAVKYIQD 463
             A ++A++++++
Sbjct: 124 EAAKEKALQFLEE 136



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 64


>BC106942-1|AAI06943.1|  531|Homo sapiens chaperonin containing
           TCP1, subunit 6A (zeta 1) protein.
          Length = 531

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 26/73 (35%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 64  LHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGF 123

Query: 425 RLACKEAVKYIQD 463
             A ++A++++++
Sbjct: 124 EAAKEKALQFLEE 136



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 64


>AM295155-1|CAL26601.1|  488|Homo sapiens chaperonin subunit 6A
           protein.
          Length = 488

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 26/73 (35%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 21  LHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGF 80

Query: 425 RLACKEAVKYIQD 463
             A ++A++++++
Sbjct: 81  EAAKEKALQFLEE 93


>AF385084-1|AAK61354.1|  531|Homo sapiens heat shock protein
           protein.
          Length = 531

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 26/73 (35%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 64  LHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGF 123

Query: 425 RLACKEAVKYIQD 463
             A ++A++++++
Sbjct: 124 EAAKEKALQFLEE 136



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 64


>AB209728-1|BAD92965.1|  529|Homo sapiens chaperonin containing
           TCP1, subunit 6A isoform a variant protein.
          Length = 529

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 26/73 (35%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 62  LHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGF 121

Query: 425 RLACKEAVKYIQD 463
             A ++A++++++
Sbjct: 122 EAAKEKALQFLEE 134



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 21  NISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 62


>AB063318-1|BAB61032.1|  531|Homo sapiens acute morphine dependence
           related protein 2 protein.
          Length = 531

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 26/73 (35%), Positives = 48/73 (65%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 64  LHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGF 123

Query: 425 RLACKEAVKYIQD 463
             A ++A++++++
Sbjct: 124 EAAKEKALQFLEE 136



 Score = 34.7 bits (76), Expect = 0.25
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 23  NISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 64


>BC027591-1|AAH27591.1|  530|Homo sapiens chaperonin containing
           TCP1, subunit 6B (zeta 2) protein.
          Length = 530

 Score = 62.1 bits (144), Expect = 1e-09
 Identities = 29/80 (36%), Positives = 50/80 (62%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 64  LDEMQIQHPTASLIAKVATAQDDVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGF 123

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A  +A++ +++ + VT E
Sbjct: 124 EAAKIKALEVLEE-VKVTKE 142



 Score = 33.1 bits (72), Expect = 0.76
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KML    GD+ +T +G  +L
Sbjct: 23  NICAARGLQDVLRTNLGPKGTMKMLASGAGDIKLTKDGNVLL 64


>BC026125-1|AAH26125.1|  530|Homo sapiens chaperonin containing
           TCP1, subunit 6B (zeta 2) protein.
          Length = 530

 Score = 62.1 bits (144), Expect = 1e-09
 Identities = 29/80 (36%), Positives = 50/80 (62%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD+  GDGTTS V+I  ELLK AD  +   +HP  I  G+
Sbjct: 64  LDEMQIQHPTASLIAKVATAQDDVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGF 123

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A  +A++ +++ + VT E
Sbjct: 124 EAAKIKALEVLEE-VKVTKE 142



 Score = 33.1 bits (72), Expect = 0.76
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +3

Query: 123 NVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           N+       ++++++LGP G  KML    GD+ +T +G  +L
Sbjct: 23  NICAARGLQDVLRTNLGPKGTMKMLASGAGDIKLTKDGNVLL 64


>D78333-1|BAA11347.1|  540|Homo sapiens testis-specific TCP20
           protein.
          Length = 540

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 28/80 (35%), Positives = 49/80 (61%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           +  ++++HP A ++ ++A  QD   GDGTT+ V+I  ELLK AD  +   +HP  I  G+
Sbjct: 63  LDEMQIQHPTASLIAKVATAQDGVTGDGTTTNVLIIGELLKQADLYISEGLHPRIIAEGF 122

Query: 425 RLACKEAVKYIQDNLTVTVE 484
             A  +A++ +++ + VT E
Sbjct: 123 EAAKIKALEVLEE-VKVTKE 141



 Score = 33.9 bits (74), Expect = 0.44
 Identities = 13/33 (39%), Positives = 23/33 (69%)
 Frame = +3

Query: 150 NIVKSSLGPVGLDKMLVDDIGDVTVTNEGATIL 248
           ++++++LGP G  KMLV   GD+ +T +G  +L
Sbjct: 31  DVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLL 63


>AL589685-11|CAI14169.1|  161|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) protein.
          Length = 161

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 32/95 (33%), Positives = 55/95 (57%), Gaps = 23/95 (24%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVII-----------------------AA 355
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+                       A 
Sbjct: 67  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILESHSVTMLECGGAILAHCNLCLPAG 126

Query: 356 ELLKNADELVKTKIHPTSIISGYRLACKEAVKYIQ 460
           E+L  A+  ++ ++HPT +IS YR A  + +  ++
Sbjct: 127 EMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLK 161



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 10  LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 68


>AL589685-9|CAI14168.1|  522|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) protein.
          Length = 522

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 24/49 (48%), Positives = 38/49 (77%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKT 391
           ++ ++V+HPAAK ++E+++ QDEEVGDGTT+VVI A    K  D+++ T
Sbjct: 67  LREIQVQHPAAKSMIEISRTQDEEVGDGTTTVVISAYR--KALDDMIST 113



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 10  LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 68


>AL589685-12|CAI14170.1|  168|Homo sapiens chaperonin containing
           TCP1, subunit 3 (gamma) protein.
          Length = 168

 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 20/35 (57%), Positives = 32/35 (91%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVII 349
           ++ ++V+HPAAK ++E+++ QDEEVGDGTTSV+I+
Sbjct: 67  LREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIIL 101



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 75  LSVAGTRSCGDPVRTQNVMXXXXXXNIVKSSLGPVGLDKMLVDDIGDVTVTNEGATILK 251
           LS    R  G  V++ N+       +I+++ LGP  + KML+D +G + +TN+G  IL+
Sbjct: 10  LSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILR 68


>CR456508-1|CAG30394.1|  557|Homo sapiens KCNMB3L protein.
          Length = 557

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>BC139842-1|AAI39843.2|  562|Homo sapiens CESK1 protein protein.
          Length = 562

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>BC100813-1|AAI00814.1|  557|Homo sapiens chaperonin containing
           TCP1, subunit 8 (theta)-like 2 protein.
          Length = 557

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>BC100812-1|AAI00813.1|  557|Homo sapiens chaperonin containing
           TCP1, subunit 8 (theta)-like 2 protein.
          Length = 557

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>BC100811-1|AAI00812.1|  557|Homo sapiens chaperonin containing
           TCP1, subunit 8 (theta)-like 2 protein.
          Length = 557

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>BC033797-1|AAH33797.1|  557|Homo sapiens chaperonin containing
           TCP1, subunit 8 (theta)-like 2 protein.
          Length = 557

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>AP003553-1|BAB43952.1|  557|Homo sapiens T-complex protein 1
           protein.
          Length = 557

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>AP000365-1|BAA84680.1|  557|Homo sapiens hypothetical protein
           protein.
          Length = 557

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 28/83 (33%), Positives = 47/83 (56%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGY 424
           ++ +E+EHPAA +L E  Q Q E  GDGT  VV++   LL+ A++L+K  +    +   Y
Sbjct: 77  LRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAY 136

Query: 425 RLACKEAVKYIQDNLTVTVESLG 493
             A  E +  +    ++ ++SLG
Sbjct: 137 ATATAEVLATLP---SLAIQSLG 156


>M34664-1|AAA36022.1|  573|Homo sapiens protein ( Human chaperonin
           (HSP60) mRNA, complete cds. ).
          Length = 573

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>M22382-1|AAA60127.1|  573|Homo sapiens mitochondrial matrix protein
           protein.
          Length = 573

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>DQ217936-1|ABB01006.1|  575|Homo sapiens heat shock protein 60
           protein.
          Length = 575

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>BC073746-1|AAH73746.1|  573|Homo sapiens heat shock 60kDa protein 1
           (chaperonin) protein.
          Length = 573

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>BC067082-1|AAH67082.1|  573|Homo sapiens heat shock 60kDa protein 1
           (chaperonin) protein.
          Length = 573

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>BC003030-1|AAH03030.1|  573|Homo sapiens heat shock 60kDa protein 1
           (chaperonin) protein.
          Length = 573

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>BC002676-1|AAH02676.1|  573|Homo sapiens heat shock 60kDa protein 1
           (chaperonin) protein.
          Length = 573

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>AJ250915-2|CAB75426.1|  573|Homo sapiens chaperonin 60, Hsp60
           protein.
          Length = 573

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>AC020550-4|AAX93145.1|  233|Homo sapiens unknown protein.
          Length = 233

 Score = 39.1 bits (87), Expect = 0.012
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +2

Query: 275 AKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHPTSIISGYRLACKEAVKY 454
           AK++ ++A   +EE GDGTT+  ++A  + K   E +    +P  I  G  LA    +  
Sbjct: 95  AKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAE 154

Query: 455 I--QDNLTVTVESLGRPSLIT 511
           +  Q     T E + + + I+
Sbjct: 155 LKKQSKPVTTPEEIAQVATIS 175


>X14830-1|CAA32939.1|  501|Homo sapiens protein ( Human mRNA for
           muscle acetylcholine receptor beta-subunit. ).
          Length = 501

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%)
 Frame = +2

Query: 314 EVGDGT-TSVVIIAAEL--LKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNLTVTVE 484
           EVGD    SV +I A+L  L   DE + TK++     + YRL+   A     D+L +T E
Sbjct: 47  EVGDRVRVSVGLILAQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAE 106

Query: 485 SLGRPSLI 508
           S+  P ++
Sbjct: 107 SVWLPDVV 114


>BC023553-1|AAH23553.1|  501|Homo sapiens cholinergic receptor,
           nicotinic, beta 1 (muscle) protein.
          Length = 501

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%)
 Frame = +2

Query: 314 EVGDGT-TSVVIIAAEL--LKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNLTVTVE 484
           EVGD    SV +I A+L  L   DE + TK++     + YRL+   A     D+L +T E
Sbjct: 47  EVGDRVRVSVGLILAQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAE 106

Query: 485 SLGRPSLI 508
           S+  P ++
Sbjct: 107 SVWLPDVV 114


>BC011371-1|AAH11371.1|  501|Homo sapiens cholinergic receptor,
           nicotinic, beta 1 (muscle) protein.
          Length = 501

 Score = 31.9 bits (69), Expect = 1.8
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%)
 Frame = +2

Query: 314 EVGDGT-TSVVIIAAEL--LKNADELVKTKIHPTSIISGYRLACKEAVKYIQDNLTVTVE 484
           EVGD    SV +I A+L  L   DE + TK++     + YRL+   A     D+L +T E
Sbjct: 47  EVGDRVRVSVGLILAQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAE 106

Query: 485 SLGRPSLI 508
           S+  P ++
Sbjct: 107 SVWLPDVV 114


>BC026355-1|AAH26355.2|  723|Homo sapiens Bardet-Biedl syndrome 10
           protein.
          Length = 723

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 12/53 (22%), Positives = 27/53 (50%)
 Frame = +2

Query: 245 IKNVEVEHPAAKVLVELAQLQDEEVGDGTTSVVIIAAELLKNADELVKTKIHP 403
           ++ + +EHP A+++V+      ++ GDG  + +I    LL+    +   +  P
Sbjct: 55  LEALHLEHPIARMIVDCVSSHLKKTGDGAKTFIIFLCHLLRGLHAITDREKDP 107


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 85,204,636
Number of Sequences: 237096
Number of extensions: 1731552
Number of successful extensions: 3614
Number of sequences better than 10.0: 76
Number of HSP's better than 10.0 without gapping: 3405
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3607
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6268037466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -