SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30109.Seq
         (654 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X63527-1|CAA45090.1|  196|Homo sapiens ribosomal protein L19 pro...   150   5e-36
S56985-1|AAB25672.1|  196|Homo sapiens ribosomal protein L19 pro...   150   5e-36
BX537435-1|CAD97677.1|  205|Homo sapiens hypothetical protein pr...   150   5e-36
BC095445-1|AAH95445.1|  196|Homo sapiens ribosomal protein L19 p...   150   5e-36
BC066315-1|AAH66315.1|  196|Homo sapiens ribosomal protein L19 p...   150   5e-36
BC062709-1|AAH62709.1|  196|Homo sapiens ribosomal protein L19 p...   150   5e-36
BC013016-1|AAH13016.1|  196|Homo sapiens ribosomal protein L19 p...   150   5e-36
BC000530-1|AAH00530.1|  196|Homo sapiens ribosomal protein L19 p...   150   5e-36
AK223082-1|BAD96802.1|  196|Homo sapiens ribosomal protein L19 v...   150   5e-36
AY157980-1|AAN76335.1|  173|Homo sapiens ribosomal protein L19 p...   119   1e-26
U17032-1|AAA95963.1| 1499|Homo sapiens p190-B protein.                 32   2.1  
BC050059-1|AAH50059.1| 1502|Homo sapiens ARHGAP5 protein protein.      32   2.1  
BC032723-1|AAH32723.1| 1189|Homo sapiens ARHGAP5 protein protein.      32   2.1  
BC110624-1|AAI10625.1|  664|Homo sapiens zinc finger protein 800...    31   2.7  
BC110623-1|AAI10624.1|  664|Homo sapiens zinc finger protein 800...    31   2.7  
AF218032-1|AAG17274.1|  337|Homo sapiens unknown protein.              31   2.7  
BC092481-1|AAH92481.1|  730|Homo sapiens PPP1R12A protein protein.     30   8.3  

>X63527-1|CAA45090.1|  196|Homo sapiens ribosomal protein L19
           protein.
          Length = 196

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>S56985-1|AAB25672.1|  196|Homo sapiens ribosomal protein L19
           protein.
          Length = 196

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>BX537435-1|CAD97677.1|  205|Homo sapiens hypothetical protein
           protein.
          Length = 205

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 10  MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 69

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 70  ARCRKNTLARRKGRHMGIGKRKGTA 94



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 81  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 140

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 141 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 190


>BC095445-1|AAH95445.1|  196|Homo sapiens ribosomal protein L19
           protein.
          Length = 196

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>BC066315-1|AAH66315.1|  196|Homo sapiens ribosomal protein L19
           protein.
          Length = 196

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>BC062709-1|AAH62709.1|  196|Homo sapiens ribosomal protein L19
           protein.
          Length = 196

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>BC013016-1|AAH13016.1|  196|Homo sapiens ribosomal protein L19
           protein.
          Length = 196

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>BC000530-1|AAH00530.1|  196|Homo sapiens ribosomal protein L19
           protein.
          Length = 196

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>AK223082-1|BAD96802.1|  196|Homo sapiens ribosomal protein L19
           variant protein.
          Length = 196

 Score =  150 bits (363), Expect = 5e-36
 Identities = 69/85 (81%), Positives = 76/85 (89%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MS L+LQKRLA+SV+RCGKKKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSR
Sbjct: 1   MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
           AR RKNT ARRKGRH G GKR+GTA
Sbjct: 61  ARCRKNTLARRKGRHMGIGKRKGTA 85



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 72  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 131

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 132 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 181


>AY157980-1|AAN76335.1|  173|Homo sapiens ribosomal protein L19
           protein.
          Length = 173

 Score =  119 bits (286), Expect = 1e-26
 Identities = 54/66 (81%), Positives = 58/66 (87%)
 Frame = +1

Query: 58  KKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEARRKGRHCGFG 237
           KKVWLDPNE NEIAN NSRQ IRK+IKDGL+I+KPV VHSRAR RKNT ARRKGRH G G
Sbjct: 1   KKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIG 60

Query: 238 KRRGTA 255
           KR+GTA
Sbjct: 61  KRKGTA 66



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/110 (50%), Positives = 71/110 (64%)
 Frame = +3

Query: 213 KGSSLWLW*EKRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 392
           KG  + +   K   NARMP+K  W                +KKIDRH+YHSLY+K KGNV
Sbjct: 53  KGRHMGIGKRKGTANARMPEKVTWMRRMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNV 112

Query: 393 FKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRR 542
           FKNKR+LME+IH+ KA+KAR K+L+DQAEARR+K KEAR      L  ++
Sbjct: 113 FKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKK 162


>U17032-1|AAA95963.1| 1499|Homo sapiens p190-B protein.
          Length = 1499

 Score = 31.9 bits (69), Expect = 2.1
 Identities = 21/72 (29%), Positives = 33/72 (45%)
 Frame = +3

Query: 357 YHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPP 536
           YH+ + K   N  KN     EYI+ +   KAR        + ++  +++ R    N L P
Sbjct: 286 YHATW-KTVSNKLKNHPDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTL-P 343

Query: 537 RRRNCCRPSLEK 572
           R  N   P+LE+
Sbjct: 344 RAFNTLLPNLEE 355


>BC050059-1|AAH50059.1| 1502|Homo sapiens ARHGAP5 protein protein.
          Length = 1502

 Score = 31.9 bits (69), Expect = 2.1
 Identities = 21/72 (29%), Positives = 33/72 (45%)
 Frame = +3

Query: 357 YHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPP 536
           YH+ + K   N  KN     EYI+ +   KAR        + ++  +++ R    N L P
Sbjct: 286 YHATW-KTVSNKLKNHPDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTL-P 343

Query: 537 RRRNCCRPSLEK 572
           R  N   P+LE+
Sbjct: 344 RAFNTLLPNLEE 355


>BC032723-1|AAH32723.1| 1189|Homo sapiens ARHGAP5 protein protein.
          Length = 1189

 Score = 31.9 bits (69), Expect = 2.1
 Identities = 21/72 (29%), Positives = 33/72 (45%)
 Frame = +3

Query: 357 YHSLYMKAKGNVFKNKRVLMEYIHRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPP 536
           YH+ + K   N  KN     EYI+ +   KAR        + ++  +++ R    N L P
Sbjct: 286 YHATW-KTVSNKLKNHPDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTL-P 343

Query: 537 RRRNCCRPSLEK 572
           R  N   P+LE+
Sbjct: 344 RAFNTLLPNLEE 355


>BC110624-1|AAI10625.1|  664|Homo sapiens zinc finger protein 800
           protein.
          Length = 664

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 426 HRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRNC 551
           H +K  K + + L    E R+N  + ++  ++NVL P  R+C
Sbjct: 248 HIRKVHKKKMEELKKYIETRKNPNQSSKGRSKNVLVPLSRSC 289


>BC110623-1|AAI10624.1|  664|Homo sapiens zinc finger protein 800
           protein.
          Length = 664

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 426 HRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRNC 551
           H +K  K + + L    E R+N  + ++  ++NVL P  R+C
Sbjct: 248 HIRKVHKKKMEELKKYIETRKNPNQSSKGRSKNVLVPLSRSC 289


>AF218032-1|AAG17274.1|  337|Homo sapiens unknown protein.
          Length = 337

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +3

Query: 426 HRKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRNC 551
           H +K  K + + L    E R+N  + ++  ++NVL P  R+C
Sbjct: 248 HIRKVHKKKMEELKKYIETRKNPNQSSKGRSKNVLVPLSRSC 289


>BC092481-1|AAH92481.1|  730|Homo sapiens PPP1R12A protein protein.
          Length = 730

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -1

Query: 294 VFVPIVPSVAYAHCSTSSLTKATVTTLST 208
           V +P+ P+V  A  ST++LT  TV T+S+
Sbjct: 630 VTIPVAPTVVNAAASTTTLTTTTVGTVSS 658


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,350,337
Number of Sequences: 237096
Number of extensions: 2080254
Number of successful extensions: 4730
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 4491
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4711
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7310122300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -