SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30108.Seq
         (591 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC062705-1|AAH62705.1|   98|Homo sapiens similar to DNA segment,...    64   3e-10
BC051802-1|AAH51802.1|   98|Homo sapiens similar to DNA segment,...    64   3e-10
BC095436-1|AAH95436.1|  108|Homo sapiens MGC71993 protein protein.     38   0.020

>BC062705-1|AAH62705.1|   98|Homo sapiens similar to DNA segment,
           Chr 11, Brigham & Womens Genetics 0434 expressed
           protein.
          Length = 98

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 30/73 (41%), Positives = 47/73 (64%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           KL+ CG+VLS WG+I L ++G+F+ + +  L+ED+PF EK+     E+    +   Y   
Sbjct: 10  KLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKD----FENGPQNIYNLYEQV 65

Query: 181 AQNCWIAALLYLI 219
           + NC+IAA LYL+
Sbjct: 66  SYNCFIAAGLYLL 78


>BC051802-1|AAH51802.1|   98|Homo sapiens similar to DNA segment,
           Chr 11, Brigham & Womens Genetics 0434 expressed
           protein.
          Length = 98

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 30/73 (41%), Positives = 47/73 (64%)
 Frame = +1

Query: 1   KLSLCGLVLSVWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLN 180
           KL+ CG+VLS WG+I L ++G+F+ + +  L+ED+PF EK+     E+    +   Y   
Sbjct: 10  KLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKD----FENGPQNIYNLYEQV 65

Query: 181 AQNCWIAALLYLI 219
           + NC+IAA LYL+
Sbjct: 66  SYNCFIAAGLYLL 78


>BC095436-1|AAH95436.1|  108|Homo sapiens MGC71993 protein protein.
          Length = 108

 Score = 38.3 bits (85), Expect = 0.020
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +1

Query: 55  LMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALLYLI 219
           ++G+F+ + +  L+ED+PF EK+     E+    +   Y   + NC+IAA LYL+
Sbjct: 38  MLGIFFNVHSAVLIEDVPFTEKD----FENGPQNIYNLYEQVSYNCFIAAGLYLL 88


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 86,735,097
Number of Sequences: 237096
Number of extensions: 1744954
Number of successful extensions: 6697
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6636
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6694
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6211568660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -