SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30104.Seq
         (674 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC040695-1|AAH40695.1|  358|Homo sapiens WBSCR16 protein protein.      63   8e-10
BC032712-1|AAH32712.1|  454|Homo sapiens WBSCR16 protein protein.      63   8e-10
BC019008-1|AAH19008.1|  464|Homo sapiens Williams-Beuren syndrom...    63   8e-10
BC007823-1|AAH07823.1|  464|Homo sapiens Williams-Beuren syndrom...    63   8e-10
AF410455-1|AAM62304.1|  464|Homo sapiens RCC1-like G exchanging ...    63   8e-10
BX538024-1|CAD97970.1|  979|Homo sapiens hypothetical protein pr...    33   1.2  
BC133009-1|AAI33010.1|  979|Homo sapiens ubiquitin specific pept...    33   1.2  
BC133007-1|AAI33008.1|  979|Homo sapiens USP37 protein protein.        33   1.2  
AL832645-1|CAD89955.1|  979|Homo sapiens hypothetical protein pr...    33   1.2  
AB046814-1|BAB13420.1|  931|Homo sapiens KIAA1594 protein protein.     33   1.2  
AY337518-1|AAR00320.1| 1024|Homo sapiens HECT E3 ubiquitin ligas...    30   6.5  
AB027289-1|BAA88519.1| 1024|Homo sapiens cyclin-E binding protei...    30   6.5  

>BC040695-1|AAH40695.1|  358|Homo sapiens WBSCR16 protein protein.
          Length = 358

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 7/144 (4%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHSPREIIL--WNFWLSYAPIYIPYKXXXXXXXXXXX 598
            S KT++  KV+G G+N DSQ+G+H  R+     + + L  +P+ +P             
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVS 180

Query: 599 XXXXHNNPDRQRRCLY-LGNNAYG 667
               H+     R  ++ +GNN+YG
Sbjct: 181 CGRAHSLVLTDREGVFSMGNNSYG 204



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +3

Query: 558 LTRAWECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           L R  E  +  V+ GRAH+++LTD+EGV++      GQC
Sbjct: 168 LDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQC 206


>BC032712-1|AAH32712.1|  454|Homo sapiens WBSCR16 protein protein.
          Length = 454

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 7/144 (4%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHSPREIIL--WNFWLSYAPIYIPYKXXXXXXXXXXX 598
            S KT++  KV+G G+N DSQ+G+H  R+     + + L  +P+ +P             
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVS 180

Query: 599 XXXXHNNPDRQRRCLY-LGNNAYG 667
               H+     R  ++ +GNN+YG
Sbjct: 181 CGRAHSLVLTDREGVFSMGNNSYG 204



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +3

Query: 558 LTRAWECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           L R  E  +  V+ GRAH+++LTD+EGV++      GQC
Sbjct: 168 LDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQC 206


>BC019008-1|AAH19008.1|  464|Homo sapiens Williams-Beuren syndrome
           chromosome region 16 protein.
          Length = 464

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 7/144 (4%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHSPREIIL--WNFWLSYAPIYIPYKXXXXXXXXXXX 598
            S KT++  KV+G G+N DSQ+G+H  R+     + + L  +P+ +P             
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVS 180

Query: 599 XXXXHNNPDRQRRCLY-LGNNAYG 667
               H+     R  ++ +GNN+YG
Sbjct: 181 CGRAHSLVLTDREGVFSMGNNSYG 204



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +3

Query: 558 LTRAWECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           L R  E  +  V+ GRAH+++LTD+EGV++      GQC
Sbjct: 168 LDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQC 206


>BC007823-1|AAH07823.1|  464|Homo sapiens Williams-Beuren syndrome
           chromosome region 16 protein.
          Length = 464

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 7/144 (4%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHSPREIIL--WNFWLSYAPIYIPYKXXXXXXXXXXX 598
            S KT++  KV+G G+N DSQ+G+H  R+     + + L  +P+ +P             
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVS 180

Query: 599 XXXXHNNPDRQRRCLY-LGNNAYG 667
               H+     R  ++ +GNN+YG
Sbjct: 181 CGRAHSLVLTDREGVFSMGNNSYG 204



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +3

Query: 558 LTRAWECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           L R  E  +  V+ GRAH+++LTD+EGV++      GQC
Sbjct: 168 LDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQC 206


>AF410455-1|AAM62304.1|  464|Homo sapiens RCC1-like G exchanging
           factor-like protein protein.
          Length = 464

 Score = 63.3 bits (147), Expect = 8e-10
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 7/144 (4%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHSPREIIL--WNFWLSYAPIYIPYKXXXXXXXXXXX 598
            S KT++  KV+G G+N DSQ+G+H  R+     + + L  +P+ +P             
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPLDRPQETRVLQVS 180

Query: 599 XXXXHNNPDRQRRCLY-LGNNAYG 667
               H+     R  ++ +GNN+YG
Sbjct: 181 CGRAHSLVLTDREGVFSMGNNSYG 204



 Score = 39.5 bits (88), Expect = 0.011
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +3

Query: 558 LTRAWECEIKAVAAGRAHTIILTDKEGVYT*VTMPMGQC 674
           L R  E  +  V+ GRAH+++LTD+EGV++      GQC
Sbjct: 168 LDRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQC 206


>BX538024-1|CAD97970.1|  979|Homo sapiens hypothetical protein
           protein.
          Length = 979

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = -2

Query: 598 AATALISHSQALVRYINRCIAKPEVPKDDFSW*MVSNLGICIDTGTEN 455
           +A   IS      + +N CI  P  P   F++   S+L +C+D+ +E+
Sbjct: 607 SAHMAISRPLKASQMVNSCITSPSTPSKKFTFKSKSSLALCLDSDSED 654


>BC133009-1|AAI33010.1|  979|Homo sapiens ubiquitin specific
           peptidase 37 protein.
          Length = 979

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = -2

Query: 598 AATALISHSQALVRYINRCIAKPEVPKDDFSW*MVSNLGICIDTGTEN 455
           +A   IS      + +N CI  P  P   F++   S+L +C+D+ +E+
Sbjct: 607 SAHMAISRPLKASQMVNSCITSPSTPSKKFTFKSKSSLALCLDSDSED 654


>BC133007-1|AAI33008.1|  979|Homo sapiens USP37 protein protein.
          Length = 979

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = -2

Query: 598 AATALISHSQALVRYINRCIAKPEVPKDDFSW*MVSNLGICIDTGTEN 455
           +A   IS      + +N CI  P  P   F++   S+L +C+D+ +E+
Sbjct: 607 SAHMAISRPLKASQMVNSCITSPSTPSKKFTFKSKSSLALCLDSDSED 654


>AL832645-1|CAD89955.1|  979|Homo sapiens hypothetical protein
           protein.
          Length = 979

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = -2

Query: 598 AATALISHSQALVRYINRCIAKPEVPKDDFSW*MVSNLGICIDTGTEN 455
           +A   IS      + +N CI  P  P   F++   S+L +C+D+ +E+
Sbjct: 607 SAHMAISRPLKASQMVNSCITSPSTPSKKFTFKSKSSLALCLDSDSED 654


>AB046814-1|BAB13420.1|  931|Homo sapiens KIAA1594 protein protein.
          Length = 931

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/48 (29%), Positives = 25/48 (52%)
 Frame = -2

Query: 598 AATALISHSQALVRYINRCIAKPEVPKDDFSW*MVSNLGICIDTGTEN 455
           +A   IS      + +N CI  P  P   F++   S+L +C+D+ +E+
Sbjct: 559 SAHMAISRPLKASQMVNSCITSPSTPSKKFTFKSKSSLALCLDSDSED 606


>AY337518-1|AAR00320.1| 1024|Homo sapiens HECT E3 ubiquitin ligase
           protein.
          Length = 1024

 Score = 30.3 bits (65), Expect = 6.5
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = +2

Query: 383 FDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIIL 520
           + +T IACG   T+A +  S+  KVF  G   D Q+G    R+ ++
Sbjct: 295 YRVTQIACGRWHTLAYV--SDLGKVFSFGSGKDGQLGNGGTRDQLM 338


>AB027289-1|BAA88519.1| 1024|Homo sapiens cyclin-E binding protein 1
           protein.
          Length = 1024

 Score = 30.3 bits (65), Expect = 6.5
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = +2

Query: 383 FDITNIACGYGFTVASIKTSEQHKVFGTGINTDSQIGYHSPREIIL 520
           + +T IACG   T+A +  S+  KVF  G   D Q+G    R+ ++
Sbjct: 295 YRVTQIACGRWHTLAYV--SDLGKVFSFGSGKDGQLGNGGTRDQLM 338


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,091,471
Number of Sequences: 237096
Number of extensions: 2130333
Number of successful extensions: 4374
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 4232
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4374
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 7615267504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -