SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha...   221   2e-57
L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha...   221   2e-57
BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation ...   221   2e-57
BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation ...   221   2e-57
AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.              221   2e-57
AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2...   221   2e-57
AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation ...   221   2e-57
AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation ...   219   1e-56
AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation ...   218   1e-56
X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for ...   218   2e-56
X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for ...   218   2e-56
J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.                 218   2e-56
EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.                218   2e-56
BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.      218   2e-56
BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alp...   218   2e-56
AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation ...   218   2e-56
AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation ...   218   2e-56
AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.   218   2e-56
L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha ...   216   6e-56
L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation el...   216   6e-56
AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alp...   216   6e-56
AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation ...   216   8e-56
AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor...   212   1e-54
AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation ...   179   1e-44
AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen HD-C...   168   2e-41
AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppres...   168   2e-41
BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.      159   9e-39
X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA frag...   145   1e-34
BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.      145   1e-34
AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation...   145   1e-34
AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation ...   145   1e-34
X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs m...   128   2e-29
U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition ...   128   2e-29
BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transitio...   128   2e-29
BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.       128   2e-29
U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.                  126   6e-29
BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisia...   126   6e-29
BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisia...   126   6e-29
AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisia...   126   6e-29
AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisia...   126   6e-29
AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.   126   6e-29
AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.    126   6e-29
AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transitio...   124   4e-28
AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens ...   124   4e-28
AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain relea...   124   4e-28
BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transitio...   123   6e-28
AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens ...   123   6e-28
BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.      108   2e-23
M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.                  97   4e-20
AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisia...    86   1e-16
AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisia...    86   1e-16
X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation ...    68   4e-11
S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.                    68   4e-11
L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu prot...    68   4e-11
BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongati...    68   4e-11
BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongati...    68   4e-11
BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.       66   9e-11
BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.       53   9e-07
BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for IM...    53   9e-07
L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.    40   0.012
BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.        40   0.012
BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondria...    40   0.012
AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation ...    40   0.012
AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial translati...    40   0.012
L19161-1|AAA19696.1|  472|Homo sapiens translation initiation fa...    36   0.11 
DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.          36   0.11 
BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for IM...    36   0.11 
BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation ...    36   0.11 
AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation ...    36   0.11 
AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.              36   0.11 
BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.       36   0.20 
AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein Sel...    36   0.20 
Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor ...    33   1.4  
X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.    33   1.4  
BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.         33   1.4  
BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.         33   1.4  
AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2 pro...    33   1.4  
BC051862-1|AAH51862.1|  672|Homo sapiens acetoacetyl-CoA synthet...    32   1.8  
BC040490-1|AAH40490.2|  672|Homo sapiens acetoacetyl-CoA synthet...    32   1.8  
AY091468-1|AAM44124.1|  665|Homo sapiens SUR5 protein.                 32   1.8  
AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens ...    32   1.8  
AK022451-1|BAB14040.1|  672|Homo sapiens protein ( Homo sapiens ...    32   1.8  
AB054121-1|BAD22560.1|  672|Homo sapiens acetoacetyl-CoA synthet...    32   1.8  
BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S....    32   2.4  
BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor, mi...    31   3.2  
BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.         31   3.2  
AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G iso...    31   3.2  
AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens ...    31   3.2  
AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2 pr...    31   3.2  
AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.              31   3.2  
BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor, mi...    31   5.6  
AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1 pr...    31   5.6  
AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G pro...    31   5.6  
BC151244-1|AAI51245.1| 1039|Homo sapiens FERM domain containing ...    30   7.4  
AL365495-1|CAI13296.1| 1039|Homo sapiens novel protein (FLJ10210...    30   7.4  
AL157392-5|CAI13127.1| 1039|Homo sapiens novel protein (FLJ10210...    30   7.4  
AB037715-1|BAA92532.1| 1051|Homo sapiens KIAA1294 protein protein.     30   7.4  

>X70940-1|CAA50280.1|  463|Homo sapiens elongation factor 1 alpha-2
           protein.
          Length = 463

 Score =  221 bits (540), Expect = 2e-57
 Identities = 107/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  P     +  +VERK
Sbjct: 199 DNMLEPSPNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>L10340-1|AAA91835.1|  435|Homo sapiens elongation factor-1 alpha
           protein.
          Length = 435

 Score =  221 bits (540), Expect = 2e-57
 Identities = 107/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 51  KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 110

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 111 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 170

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  P     +  +VERK
Sbjct: 171 DNMLEPSPNMPWFKGWKVERK 191



 Score = 87.4 bits (207), Expect = 5e-17
 Identities = 39/40 (97%), Positives = 39/40 (97%)
 Frame = +1

Query: 109 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           YKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERE
Sbjct: 1   YKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERE 40


>BC110409-1|AAI10410.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  221 bits (540), Expect = 2e-57
 Identities = 107/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  P     +  +VERK
Sbjct: 199 DNMLEPSPNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC000432-1|AAH00432.1|  463|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 protein.
          Length = 463

 Score =  221 bits (540), Expect = 2e-57
 Identities = 107/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  P     +  +VERK
Sbjct: 199 DNMLEPSPNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AL121829-9|CAC15522.1|  463|Homo sapiens EEF1A2 protein.
          Length = 463

 Score =  221 bits (540), Expect = 2e-57
 Identities = 107/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  P     +  +VERK
Sbjct: 199 DNMLEPSPNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AF163763-1|AAF80488.1|  463|Homo sapiens elongation factor 1 A-2
           protein.
          Length = 463

 Score =  221 bits (540), Expect = 2e-57
 Identities = 107/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  P     +  +VERK
Sbjct: 199 DNMLEPSPNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AB209064-1|BAD92301.1|  340|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 2 variant protein.
          Length = 340

 Score =  221 bits (540), Expect = 2e-57
 Identities = 107/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYY+TIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 55  KFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 114

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEP Y      +  ++     KKIGYNPA V FVPISGWHG
Sbjct: 115 LAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHG 174

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE  P     +  +VERK
Sbjct: 175 DNMLEPSPNMPWFKGWKVERK 195



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/21 (95%), Positives = 21/21 (100%)
 Frame = +1

Query: 166 EMGKGSFKYAWVLDKLKAERE 228
           +MGKGSFKYAWVLDKLKAERE
Sbjct: 24  QMGKGSFKYAWVLDKLKAERE 44


>AK223046-1|BAD96766.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  219 bits (534), Expect = 1e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIAKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222551-1|BAD96271.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  218 bits (533), Expect = 1e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWEVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>X16869-1|CAA34756.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1-alpha (clone CEF4). ).
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>X03558-1|CAA27245.1|  462|Homo sapiens protein ( Human mRNA for
           elongation factor 1 alpha subunit (EF-1 alpha). ).
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>J04617-1|AAA52343.1|  462|Homo sapiens EEF1A protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>EF362804-1|ABO30531.1|  462|Homo sapiens EF1a protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC111051-1|AAI11052.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC082268-1|AAH82268.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC072385-1|AAH72385.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC071841-1|AAH71841.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC071741-1|AAH71741.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC071727-1|AAH71727.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  141 bits (341), Expect = 3e-33
 Identities = 66/68 (97%), Positives = 66/68 (97%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKFGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC066893-1|AAH66893.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC057391-1|AAH57391.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC038339-1|AAH38339.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC028674-1|AAH28674.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC021686-1|AAH21686.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC019669-1|AAH19669.1|  462|Homo sapiens EEF1A1 protein protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC018641-1|AAH18641.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC018150-1|AAH18150.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC014224-1|AAH14224.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC012891-1|AAH12891.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC010735-1|AAH10735.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC009875-1|AAH09875.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC009733-1|AAH09733.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BC008587-1|AAH08587.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AY043301-1|AAK95378.1|  462|Homo sapiens elongation factor 1-alpha
           protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AL603910-8|CAI14883.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AL593851-4|CAH73620.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha-like 3 protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK223030-1|BAD96750.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222982-1|BAD96702.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSAYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222523-1|BAD96243.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AK222515-1|BAD96235.1|  462|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 462

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AF397403-1|AAK93966.1|  398|Homo sapiens translation elongation
           factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 15  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 74

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 75  LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 134

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 135 DNMLEPSANMPWFKGWKVTRK 155


>AF267861-1|AAG44730.1|  427|Homo sapiens EF1a-like protein protein.
          Length = 427

 Score =  218 bits (532), Expect = 2e-56
 Identities = 107/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSANMPWFKGWKVTRK 219



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>L41498-1|AAC09386.1|  398|Homo sapiens longation factor 1-alpha 1
           protein.
          Length = 398

 Score =  216 bits (528), Expect = 6e-56
 Identities = 106/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 15  KFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 74

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 75  LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 134

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 135 DNMLEPSANMPWFKGWKVTRK 155


>L41490-1|AAC09385.1|  398|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1-like 14 protein.
          Length = 398

 Score =  216 bits (528), Expect = 6e-56
 Identities = 106/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 15  KFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 74

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 75  LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 134

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 135 DNMLEPSANMPWFKGWKVTRK 155


>AY062434-1|AAL38981.1|  398|Homo sapiens elongation factor 1-alpha
           1 protein.
          Length = 398

 Score =  216 bits (528), Expect = 6e-56
 Identities = 106/141 (75%), Positives = 114/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFI+NMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 15  KFETSKYYVTIIDAPGHRDFIQNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 74

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 75  LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 134

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 135 DNMLEPSANMPWFKGWKVTRK 155


>AK223042-1|BAD96762.1|  433|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 433

 Score =  216 bits (527), Expect = 8e-56
 Identities = 106/141 (75%), Positives = 113/141 (80%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVT IDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 50  KFETSKYYVTTIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 109

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 110 LAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNG 169

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 170 DNMLEPSANMPWFKGWKVTRK 190



 Score = 84.6 bits (200), Expect = 3e-16
 Identities = 38/39 (97%), Positives = 38/39 (97%)
 Frame = +1

Query: 112 KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           KCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERE
Sbjct: 1   KCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERE 39


>AF174496-1|AAF36537.1|  426|Homo sapiens glucocorticoid receptor
           AF-1 specific elongation factor protein.
          Length = 426

 Score =  212 bits (518), Expect = 1e-54
 Identities = 105/141 (74%), Positives = 112/141 (79%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 43  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 102

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA+TLGVKQLIVGVNK  STEPPY      +  ++     KKIGYNP  VAFVPISGW+G
Sbjct: 103 LAYTLGVKQLIVGVNKSHSTEPPYSQKRYEEIVKEVRTYIKKIGYNPDTVAFVPISGWNG 162

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 163 DNMLEPSANMPWFKGWKVTRK 183



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 26/28 (92%), Positives = 26/28 (92%)
 Frame = +1

Query: 145 KFEKEAQEMGKGSFKYAWVLDKLKAERE 228
           KFEKEA EMGKGSFKYAWV DKLKAERE
Sbjct: 5   KFEKEAAEMGKGSFKYAWVWDKLKAERE 32


>AK222519-1|BAD96239.1|  366|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 variant protein.
          Length = 366

 Score =  179 bits (435), Expect = 1e-44
 Identities = 89/123 (72%), Positives = 96/123 (78%)
 Frame = +2

Query: 311 DFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMD 490
           DFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMD
Sbjct: 1   DFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMD 60

Query: 491 STEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQV 670
           STEPPY      +  ++     KKIGYNP  VAFVPISGW+GDNMLE        +  +V
Sbjct: 61  STEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKV 120

Query: 671 ERK 679
            RK
Sbjct: 121 TRK 123


>AF328730-1|AAN09722.1|  361|Homo sapiens CTCL tumor antigen
           HD-CL-08 protein.
          Length = 361

 Score =  168 bits (408), Expect = 2e-41
 Identities = 84/118 (71%), Positives = 91/118 (77%)
 Frame = +2

Query: 326 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 505
           MITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPP
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPP 60

Query: 506 YVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERK 679
           Y      +  ++     KKIGYNP  VAFVPISGW+GDNMLE        +  +V RK
Sbjct: 61  YSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRK 118


>AF322220-1|AAN51932.1|  361|Homo sapiens cervical cancer suppressor
           3 protein.
          Length = 361

 Score =  168 bits (408), Expect = 2e-41
 Identities = 84/118 (71%), Positives = 91/118 (77%)
 Frame = +2

Query: 326 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 505
           MITGTSQADCAVLIVAAG GEFEAGISKNGQTREHALLA+TLGVKQLIVGVNKMDSTEPP
Sbjct: 1   MITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPP 60

Query: 506 YVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERK 679
           Y      +  ++     KKIGYNP  VAFVPISGW+GDNMLE        +  +V RK
Sbjct: 61  YSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRK 118


>BC071619-1|AAH71619.1|  441|Homo sapiens EEF1A1 protein protein.
          Length = 441

 Score =  159 bits (386), Expect = 9e-39
 Identities = 92/141 (65%), Positives = 99/141 (70%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LA++    + IV   K  ST   Y+               KKIGYNP  VAFVPISGW+G
Sbjct: 139 LAYSQKRYEEIV---KEVST---YI---------------KKIGYNPDTVAFVPISGWNG 177

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 178 DNMLEPSANMPWFKGWKVTRK 198



 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>X03689-1|CAA27325.1|   94|Homo sapiens protein ( Human mRNA
           fragment for elongation factor TU (N-terminus). ).
          Length = 94

 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 36.7 bits (81), Expect = 0.085
 Identities = 15/16 (93%), Positives = 16/16 (100%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPG 304
           KFET+KYYVTIIDAPG
Sbjct: 79  KFETAKYYVTIIDAPG 94


>BC070131-1|AAH70131.1|  111|Homo sapiens EEF1A1 protein protein.
          Length = 111

 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AL603910-10|CAO03613.1|  107|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 107

 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 65.7 bits (153), Expect = 2e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTS 343
           KFETSKYYVTIIDAPGHRDFIKNMITGTS
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTS 107


>AL603910-9|CAI40951.1|  145|Homo sapiens eukaryotic translation
           elongation factor 1 alpha 1 protein.
          Length = 145

 Score =  145 bits (352), Expect = 1e-34
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVL
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score =  138 bits (334), Expect = 2e-32
 Identities = 65/67 (97%), Positives = 66/67 (98%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG GEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGV 457
           LA+TLGV
Sbjct: 139 LAYTLGV 145


>X17644-1|CAA35635.1|  499|Homo sapiens protein ( Human GST1-Hs mRNA
           for GTP-binding protein. ).
          Length = 499

 Score =  128 bits (310), Expect = 2e-29
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 147 FETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 206

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     + +    + + K     KK+G+NP   + F+P SG  G
Sbjct: 207 AKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 266

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 267 ANLKEQSDFC 276



 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 126 ALDTNQEERD 135


>U95742-2|AAB67250.1|  499|Homo sapiens G1 to S phase transition
           protein protein.
          Length = 499

 Score =  128 bits (310), Expect = 2e-29
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 147 FETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 206

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     + +    + + K     KK+G+NP   + F+P SG  G
Sbjct: 207 AKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 266

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 267 ANLKEQSDFC 276



 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 66  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 125

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 126 ALDTNQEERD 135


>BT006722-1|AAP35368.1|  498|Homo sapiens G1 to S phase transition 1
           protein.
          Length = 498

 Score =  128 bits (310), Expect = 2e-29
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 146 FETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 205

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     + +    + + K     KK+G+NP   + F+P SG  G
Sbjct: 206 AKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 265

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 266 ANLKEQSDFC 275



 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 65  PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 124

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 125 ALDTNQEERD 134


>BC009503-1|AAH09503.2|  633|Homo sapiens GSPT1 protein protein.
          Length = 633

 Score =  128 bits (310), Expect = 2e-29
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET K + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 281 FETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 340

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     + +    + + K     KK+G+NP   + F+P SG  G
Sbjct: 341 AKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTG 400

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 401 ANLKEQSDFC 410



 Score = 77.0 bits (181), Expect = 7e-14
 Identities = 32/70 (45%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G ++Y  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 200 PPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSW 259

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 260 ALDTNQEERD 269


>U87791-1|AAD00645.1|  684|Homo sapiens eRFS protein.
          Length = 684

 Score =  126 bits (305), Expect = 6e-29
 Identities = 62/124 (50%), Positives = 80/124 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH L
Sbjct: 332 KFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGL 391

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V VNKMD     +     ++   K  H  K+ G+  + V F+P SG  G
Sbjct: 392 LVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449

Query: 617 DNML 628
           +N++
Sbjct: 450 ENLI 453



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>BC040849-1|AAH40849.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  126 bits (305), Expect = 6e-29
 Identities = 62/124 (50%), Positives = 80/124 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH L
Sbjct: 332 KFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGL 391

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V VNKMD     +     ++   K  H  K+ G+  + V F+P SG  G
Sbjct: 392 LVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449

Query: 617 DNML 628
           +N++
Sbjct: 450 ENLI 453



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>BC001465-1|AAH01465.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  126 bits (305), Expect = 6e-29
 Identities = 62/124 (50%), Positives = 80/124 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH L
Sbjct: 332 KFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGL 391

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V VNKMD     +     ++   K  H  K+ G+  + V F+P SG  G
Sbjct: 392 LVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449

Query: 617 DNML 628
           +N++
Sbjct: 450 ENLI 453



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>AL445190-5|CAI95161.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  126 bits (305), Expect = 6e-29
 Identities = 62/124 (50%), Positives = 80/124 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH L
Sbjct: 332 KFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGL 391

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V VNKMD     +     ++   K  H  K+ G+  + V F+P SG  G
Sbjct: 392 LVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449

Query: 617 DNML 628
           +N++
Sbjct: 450 ENLI 453



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>AL353596-2|CAI17912.1|  684|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 684

 Score =  126 bits (305), Expect = 6e-29
 Identities = 62/124 (50%), Positives = 80/124 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH L
Sbjct: 332 KFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGL 391

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V VNKMD     +     ++   K  H  K+ G+  + V F+P SG  G
Sbjct: 392 LVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449

Query: 617 DNML 628
           +N++
Sbjct: 450 ENLI 453



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>AJ459826-1|CAD30873.1|  684|Homo sapiens HBS1-like protein protein.
          Length = 684

 Score =  126 bits (305), Expect = 6e-29
 Identities = 62/124 (50%), Positives = 80/124 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH L
Sbjct: 332 KFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGL 391

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V VNKMD     +     ++   K  H  K+ G+  + V F+P SG  G
Sbjct: 392 LVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 449

Query: 617 DNML 628
           +N++
Sbjct: 450 ENLI 453



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>AB028961-1|BAA82990.1|  496|Homo sapiens KIAA1038 protein protein.
          Length = 496

 Score =  126 bits (305), Expect = 6e-29
 Identities = 62/124 (50%), Positives = 80/124 (64%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+   +T++DAPGH+DFI NMITG +QAD AVL+V A  GEFEAG    GQTREH L
Sbjct: 144 KFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGL 203

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V VNKMD     +     ++   K  H  K+ G+  + V F+P SG  G
Sbjct: 204 LVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSG 261

Query: 617 DNML 628
           +N++
Sbjct: 262 ENLI 265



 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 70  KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 129

Query: 217 AERE 228
            ERE
Sbjct: 130 EERE 133


>AL929101-2|CAH71524.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  124 bits (298), Expect = 4e-28
 Identities = 62/130 (47%), Positives = 81/130 (62%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 276 FETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 335

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     +      + + K     KK+G++P   + F+P SG  G
Sbjct: 336 AKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 395

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 396 ANIKEQSDFC 405



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 255 ALDTNQEERD 264


>AK023155-1|BAB14435.1|  504|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13093 fis, clone NT2RP3002151, highly similar to
           G1 TO S PHASE TRANSITION PROTEIN 1 HOMOLOG. ).
          Length = 504

 Score =  124 bits (298), Expect = 4e-28
 Identities = 62/130 (47%), Positives = 81/130 (62%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 173 FETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 232

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     +      + + K     KK+G++P   + F+P SG  G
Sbjct: 233 AKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 292

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 293 ANIKEQSDFC 302



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 92  PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 151

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 152 ALDTNQEERD 161


>AJ251548-1|CAB91089.1|  628|Homo sapiens polypeptide chain release
           factor 3b protein.
          Length = 628

 Score =  124 bits (298), Expect = 4e-28
 Identities = 62/130 (47%), Positives = 81/130 (62%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 276 FETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 335

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     +      + + K     KK+G++P   + F+P SG  G
Sbjct: 336 AKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 395

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 396 ANIKEQSDFC 405



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 255 ALDTNQEERD 264


>BC036077-1|AAH36077.1|  628|Homo sapiens G1 to S phase transition 2
           protein.
          Length = 628

 Score =  123 bits (297), Expect = 6e-28
 Identities = 62/130 (47%), Positives = 81/130 (62%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 276 FETERKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 335

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     +      + + K     KK+G++P   + F+P SG  G
Sbjct: 336 AKTAGVKHLIVLINKMDDHTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 395

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 396 ANIKEQSDFC 405



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 255 ALDTNQEERD 264


>AK001303-1|BAA91612.1|  628|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10441 fis, clone NT2RP1000733, highly similar to
           Human mRNA for GSPT1-TK protein. ).
          Length = 628

 Score =  123 bits (297), Expect = 6e-28
 Identities = 62/130 (47%), Positives = 81/130 (62%), Gaps = 1/130 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET + + TI+DAPGH+ F+ NMI G SQAD AVL+++A  GEFE G  K GQTREHA+L
Sbjct: 276 FETERKHFTILDAPGHKGFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAML 335

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK LIV +NKMD     +      + + K     KK+G++P   + F+P SG  G
Sbjct: 336 AKTAGVKHLIVLINKMDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTG 395

Query: 617 DNMLELQPKC 646
            N+ E    C
Sbjct: 396 ANIKEQSDFC 405



 Score = 75.8 bits (178), Expect = 2e-13
 Identities = 31/70 (44%), Positives = 49/70 (70%)
 Frame = +1

Query: 19  PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAW 198
           P    +K H+N+V IGHVD+GKST  G +++  G +DKRT+EK+E+EA+E  + ++  +W
Sbjct: 195 PSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSW 254

Query: 199 VLDKLKAERE 228
            LD  + ER+
Sbjct: 255 ALDTNQEERD 264


>BC070500-1|AAH70500.1|   67|Homo sapiens EEF1A1 protein protein.
          Length = 67

 Score =  108 bits (259), Expect = 2e-23
 Identities = 49/51 (96%), Positives = 50/51 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGK 177
           MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA EMG+
Sbjct: 1   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGR 51


>M29548-1|AAA52367.1|  327|Homo sapiens EEF1A protein.
          Length = 327

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 49/82 (59%), Positives = 56/82 (68%)
 Frame = +2

Query: 434 LLAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWH 613
           LLA+TLGVKQLIVGVNKMDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+
Sbjct: 3   LLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWN 62

Query: 614 GDNMLELQPKCLGSRDGQVERK 679
           GDNMLE        +  +V RK
Sbjct: 63  GDNMLEPSANMPWFKGWKVTRK 84


>AL445190-4|CAI95162.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>AL353596-1|CAI17913.1|  453|Homo sapiens HBS1-like (S. cerevisiae)
           protein.
          Length = 453

 Score = 86.2 bits (204), Expect = 1e-16
 Identities = 37/64 (57%), Positives = 50/64 (78%)
 Frame = +1

Query: 37  KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 216
           K  +N+VVIGHVD+GKST  GH++Y  G I+KRT+ K+E+E+++ GK SF YAWVLD+  
Sbjct: 258 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETG 317

Query: 217 AERE 228
            ERE
Sbjct: 318 EERE 321


>X84694-1|CAA59169.1|  452|Homo sapiens mitochondrial elongation
           factor Tu protein.
          Length = 452

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/81 (41%), Positives = 49/81 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          QTREH L
Sbjct: 114 EYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------QTREHLL 166

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV+ ++V VNK D+ +
Sbjct: 167 LARQIGVEHVVVYVNKADAVQ 187



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 180
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>S75463-1|AAC60647.1|  452|Homo sapiens P43 protein.
          Length = 452

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/81 (41%), Positives = 49/81 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          QTREH L
Sbjct: 117 EYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------QTREHLL 169

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV+ ++V VNK D+ +
Sbjct: 170 LARQIGVEHVVVYVNKADAVQ 190



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 180
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>L38995-1|AAB00499.1|  452|Homo sapiens elongation factor Tu
           protein.
          Length = 452

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/81 (41%), Positives = 49/81 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          QTREH L
Sbjct: 114 EYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------QTREHLL 166

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV+ ++V VNK D+ +
Sbjct: 167 LARQIGVEHVVVYVNKADAVQ 187



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 180
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 53  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 105


>BC010041-1|AAH10041.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/81 (41%), Positives = 49/81 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          QTREH L
Sbjct: 117 EYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------QTREHLL 169

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV+ ++V VNK D+ +
Sbjct: 170 LARQIGVEHVVVYVNKADAVQ 190



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 180
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>BC001633-1|AAH01633.2|  455|Homo sapiens Tu translation elongation
           factor, mitochondrial protein.
          Length = 455

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 34/81 (41%), Positives = 49/81 (60%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           ++ T+  +    D PGH D++KNMITGT+  D  +L+VAA  G          QTREH L
Sbjct: 117 EYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMP-------QTREHLL 169

Query: 437 LAFTLGVKQLIVGVNKMDSTE 499
           LA  +GV+ ++V VNK D+ +
Sbjct: 170 LARQIGVEHVVVYVNKADAVQ 190



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTTG---HLIYKCGGIDKRTIEKFEKEAQEMGKG 180
           ++K H+N+  IGHVD GK+T T     ++ + GG   +  E+ +   +E  +G
Sbjct: 56  RDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARG 108


>BC094687-1|AAH94687.1|  308|Homo sapiens EEF1A1 protein protein.
          Length = 308

 Score = 66.5 bits (155), Expect = 9e-11
 Identities = 33/65 (50%), Positives = 39/65 (60%)
 Frame = +2

Query: 485 MDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDG 664
           MDSTEPPY      +  ++     KKIGYNP  VAFVPISGW+GDNMLE        +  
Sbjct: 1   MDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGW 60

Query: 665 QVERK 679
           +V RK
Sbjct: 61  KVTRK 65


>BC063511-1|AAH63511.1|  290|Homo sapiens EEF1A1 protein protein.
          Length = 290

 Score = 53.2 bits (122), Expect = 9e-07
 Identities = 25/41 (60%), Positives = 28/41 (68%)
 Frame = +2

Query: 557 KKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERK 679
           KKIGYNP  VAFVPISGW+GDNMLE        +  +V RK
Sbjct: 7   KKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRK 47


>BC014377-1|AAH14377.1|  287|Homo sapiens Unknown (protein for
           IMAGE:4041545) protein.
          Length = 287

 Score = 53.2 bits (122), Expect = 9e-07
 Identities = 25/41 (60%), Positives = 28/41 (68%)
 Frame = +2

Query: 557 KKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERK 679
           KKIGYNP  VAFVPISGW+GDNMLE        +  +V RK
Sbjct: 4   KKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRK 44


>L34600-1|AAA67038.1|  727|Homo sapiens initiation factor 2 protein.
          Length = 727

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 461 QLIVGVNKMDSTEPPYVSPD-LRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +I+ VNK D  E     P+ ++K    Y    +  G     V  VP+S   GDN++ L
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLMAL 334


>BC064977-1|AAH64977.1|  465|Homo sapiens MTIF2 protein protein.
          Length = 465

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 461 QLIVGVNKMDSTEPPYVSPD-LRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +I+ VNK D  E     P+ ++K    Y    +  G     V  VP+S   GDN++ L
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLMAL 334


>BC039848-1|AAH39848.1|  500|Homo sapiens Similar to mitochondrial
           translational initiation factor 2 protein.
          Length = 500

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 461 QLIVGVNKMDSTEPPYVSPD-LRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +I+ VNK D  E     P+ ++K    Y    +  G     V  VP+S   GDN++ L
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLMAL 334


>AF495546-1|AAM70196.1|  727|Homo sapiens translation initiation
           factor 2 protein.
          Length = 727

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 461 QLIVGVNKMDSTEPPYVSPD-LRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +I+ VNK D  E     P+ ++K    Y    +  G     V  VP+S   GDN++ L
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLMAL 334


>AF494407-1|AAM14617.1|  727|Homo sapiens mitochondrial
           translation-initiation factor 2 protein.
          Length = 727

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           +T +D PGH  F      G    D  VL+VAA  G  +  +    ++ +HA  A      
Sbjct: 230 ITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTV----ESIQHAKDAQV---- 281

Query: 461 QLIVGVNKMDSTEPPYVSPD-LRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLEL 634
            +I+ VNK D  E     P+ ++K    Y    +  G     V  VP+S   GDN++ L
Sbjct: 282 PIILAVNKCDKAE---ADPEKVKKELLAYDVVCEDYG---GDVQAVPVSALTGDNLMAL 334


>L19161-1|AAA19696.1|  472|Homo sapiens translation initiation
           factor eIF-2 gamma subunit protein.
          Length = 472

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 458 KQLIVGVNKMD 490
           K +++  NK+D
Sbjct: 183 KHILILQNKID 193


>DQ120619-1|ABB92405.1|  471|Homo sapiens eFI-2-gamma protein.
          Length = 471

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 458 KQLIVGVNKMD 490
           K +++  NK+D
Sbjct: 183 KHILILQNKID 193


>BC087847-1|AAH87847.1|  465|Homo sapiens Unknown (protein for
           IMAGE:30389268) protein.
          Length = 465

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 128 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 181

Query: 458 KQLIVGVNKMD 490
           K +++  NK+D
Sbjct: 182 KHILILQNKID 192


>BC019906-1|AAH19906.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa protein.
          Length = 472

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 458 KQLIVGVNKMD 490
           K +++  NK+D
Sbjct: 183 KHILILQNKID 193


>AK222577-1|BAD96297.1|  472|Homo sapiens eukaryotic translation
           initiation factor 2, subunit 3 gamma, 52kDa variant
           protein.
          Length = 472

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 129 HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 182

Query: 458 KQLIVGVNKMD 490
           K +++  NK+D
Sbjct: 183 KHILILQNKID 193


>AJ006932-1|CAA07331.1|  248|Homo sapiens eIF-2gA protein.
          Length = 248

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 19/71 (26%), Positives = 34/71 (47%)
 Frame = +2

Query: 278 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 457
           +V+ +D PGH   +  M+ G +  D A+L++A              QT EH      + +
Sbjct: 69  HVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKL 122

Query: 458 KQLIVGVNKMD 490
           K +++  NK+D
Sbjct: 123 KHILILQNKID 133


>BC007933-1|AAH07933.1|  569|Homo sapiens EEFSEC protein protein.
          Length = 569

 Score = 35.5 bits (78), Expect = 0.20
 Identities = 26/113 (23%), Positives = 51/113 (45%), Gaps = 1/113 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE-HALLAFTLGV 457
           VT++D PGH   I+ +I G    D  +L++          ++K  QT+    L+   +  
Sbjct: 61  VTLVDCPGHASLIRTIIGGAQIIDLMMLVI---------DVTKGMQTQSAECLVIGQIAC 111

Query: 458 KQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           ++L+V +NK+D          + K  +K   T +   +  A +  +P++   G
Sbjct: 112 QKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRGAPI--IPVAAKPG 162


>AF268872-1|AAG13375.1|  526|Homo sapiens MJ0495-like protein SelB
           protein.
          Length = 526

 Score = 35.5 bits (78), Expect = 0.20
 Identities = 26/113 (23%), Positives = 51/113 (45%), Gaps = 1/113 (0%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE-HALLAFTLGV 457
           VT++D PGH   I+ +I G    D  +L++          ++K  QT+    L+   +  
Sbjct: 18  VTLVDCPGHASLIRTIIGGAQIIDLMMLVI---------DVTKGMQTQSAECLVIGQIAC 68

Query: 458 KQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           ++L+V +NK+D          + K  +K   T +   +  A +  +P++   G
Sbjct: 69  QKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRGAPI--IPVAAKPG 119


>Z11692-1|CAA77750.1|  858|Homo sapiens human  elongation factor 2
           protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>X51466-1|CAA35829.1|  858|Homo sapiens elongation factor 2 protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>BC126259-1|AAI26260.1|  858|Homo sapiens EEF2 protein protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>BC006547-1|AAH06547.1|  583|Homo sapiens EEF2 protein protein.
          Length = 583

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>AY942181-1|AAX34409.1|  858|Homo sapiens elongation factor 2
           protein.
          Length = 858

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKANIRNMSVIAHVDHGKSTLTDSLVCKAG 44


>BC051862-1|AAH51862.1|  672|Homo sapiens acetoacetyl-CoA synthetase
           protein.
          Length = 672

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -1

Query: 529 FPQIWAHVWWFSGIHFVYSYDELFDT 452
           +   WA  W FSGI F   YDE+ DT
Sbjct: 58  YSDFWAEFWKFSGIVFSRVYDEVVDT 83


>BC040490-1|AAH40490.2|  672|Homo sapiens acetoacetyl-CoA synthetase
           protein.
          Length = 672

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -1

Query: 529 FPQIWAHVWWFSGIHFVYSYDELFDT 452
           +   WA  W FSGI F   YDE+ DT
Sbjct: 58  YSDFWAEFWKFSGIVFSRVYDEVVDT 83


>AY091468-1|AAM44124.1|  665|Homo sapiens SUR5 protein.
          Length = 665

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -1

Query: 529 FPQIWAHVWWFSGIHFVYSYDELFDT 452
           +   WA  W FSGI F   YDE+ DT
Sbjct: 51  YSDFWAEFWKFSGIVFSRVYDEVVDT 76


>AK023282-1|BAB14507.1|  669|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13220 fis, clone NT2RP4002047, moderately
           similar to GTP-BINDING PROTEIN LEPA. ).
          Length = 669

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 132
           N  ++ HVD GKST T  L+   G IDK
Sbjct: 70  NFSIVAHVDHGKSTLTDRLLELTGTIDK 97



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           E  +Y + +ID PGH DF   +    S     +L+V A  G          QT  +  LA
Sbjct: 130 EGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG-------IQAQTVANFFLA 182

Query: 443 FTLGVKQLIVGVNKMD--STEPPYVSPDLRK 529
           F   +  + V +NK+D  + +P  V   + K
Sbjct: 183 FEAQLSVIPV-INKIDLKNADPERVENQIEK 212


>AK022451-1|BAB14040.1|  672|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12389 fis, clone MAMMA1002671, weakly similar to
           ACETYL-COENZYME A SYNTHETASE (EC 6.2.1.1). ).
          Length = 672

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -1

Query: 529 FPQIWAHVWWFSGIHFVYSYDELFDT 452
           +   WA  W FSGI F   YDE+ DT
Sbjct: 58  YSDFWAEFWKFSGIVFSRVYDEVVDT 83


>AB054121-1|BAD22560.1|  672|Homo sapiens acetoacetyl-CoA synthetase
           protein.
          Length = 672

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -1

Query: 529 FPQIWAHVWWFSGIHFVYSYDELFDT 452
           +   WA  W FSGI F   YDE+ DT
Sbjct: 58  YSDFWAEFWKFSGIVFSRVYDEVVDT 83


>BC036768-1|AAH36768.1|  669|Homo sapiens GUF1 GTPase homolog (S.
           cerevisiae) protein.
          Length = 669

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLA 442
           E  +Y + +ID PGH DF   +    S     +L+V A  G          QT  +  LA
Sbjct: 130 EGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEG-------IQAQTVANFFLA 182

Query: 443 FTLGVKQLIVGVNKMD--STEPPYVSPDLRK 529
           F   +  + V +NK+D  + +P  V   + K
Sbjct: 183 FEAQLSVIPV-INKIDLKNADPERVENQIEK 212



 Score = 30.3 bits (65), Expect = 7.4
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 132
           N  ++ HVD GKST    L+   G IDK
Sbjct: 70  NFSIVAHVDHGKSTLADRLLELTGTIDK 97


>BC030612-1|AAH30612.1|  777|Homo sapiens G elongation factor,
           mitochondrial 2 protein.
          Length = 777

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>BC015712-1|AAH15712.1|  779|Homo sapiens GFM2 protein protein.
          Length = 779

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AY453587-1|AAS49035.1|  531|Homo sapiens elongation factor G
           isoform protein.
          Length = 531

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AK025314-1|BAB15109.1|  513|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21661 fis, clone COL08837. ).
          Length = 513

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AF367997-1|AAK53401.1|  779|Homo sapiens elongation factor G2
           protein.
          Length = 779

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>AF111808-1|AAL39010.1|  732|Homo sapiens MSTP027 protein.
          Length = 732

 Score = 31.5 bits (68), Expect = 3.2
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 72  NIGIMAHIDAGKTTTTERILYYSG 95


>BC049210-1|AAH49210.1|  751|Homo sapiens G elongation factor,
           mitochondrial 1 protein.
          Length = 751

 Score = 30.7 bits (66), Expect = 5.6
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 132
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>AF367998-1|AAK53402.1|  751|Homo sapiens elongation factor G1
           protein.
          Length = 751

 Score = 30.7 bits (66), Expect = 5.6
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 132
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>AF309777-1|AAK58877.1|  751|Homo sapiens elongation factor G
           protein.
          Length = 751

 Score = 30.7 bits (66), Expect = 5.6
 Identities = 13/28 (46%), Positives = 18/28 (64%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCGGIDK 132
           NI +  H+DSGK+T T  ++Y  G I K
Sbjct: 48  NIGISAHIDSGKTTLTERVLYYTGRIAK 75


>BC151244-1|AAI51245.1| 1039|Homo sapiens FERM domain containing 4A
           protein.
          Length = 1039

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 512 SPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRD 661
           +PDLR     Y H+ + +  +P  +  + +   H  + LE Q K LGS +
Sbjct: 674 TPDLRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSEN 723


>AL365495-1|CAI13296.1| 1039|Homo sapiens novel protein (FLJ10210)
           protein.
          Length = 1039

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 512 SPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRD 661
           +PDLR     Y H+ + +  +P  +  + +   H  + LE Q K LGS +
Sbjct: 674 TPDLRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSEN 723


>AL157392-5|CAI13127.1| 1039|Homo sapiens novel protein (FLJ10210)
           protein.
          Length = 1039

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 512 SPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRD 661
           +PDLR     Y H+ + +  +P  +  + +   H  + LE Q K LGS +
Sbjct: 674 TPDLRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSEN 723


>AB037715-1|BAA92532.1| 1051|Homo sapiens KIAA1294 protein protein.
          Length = 1051

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 512 SPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRD 661
           +PDLR     Y H+ + +  +P  +  + +   H  + LE Q K LGS +
Sbjct: 686 TPDLRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSEN 735


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,272,548
Number of Sequences: 237096
Number of extensions: 2383288
Number of successful extensions: 4990
Number of sequences better than 10.0: 121
Number of HSP's better than 10.0 without gapping: 4648
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4925
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8623170556
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -