SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30097.Seq
         (631 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X78711-1|CAA55364.1|  553|Homo sapiens glycerol kinase protein.        56   1e-07
BC066960-1|AAH66960.1|  553|Homo sapiens GK3P protein protein.         55   2e-07
X69886-1|CAA49512.1|  395|Homo sapiens glycerol kinase protein.        54   6e-07
L13943-1|AAA52576.1|  524|Homo sapiens glycerol kinase protein.        54   6e-07
BC071595-1|AAH71595.1|  530|Homo sapiens glycerol kinase protein.      54   6e-07
BC042421-1|AAH42421.1|  530|Homo sapiens glycerol kinase protein.      54   6e-07
BC037549-1|AAH37549.1|  524|Homo sapiens glycerol kinase protein.      54   6e-07
AJ252550-3|CAB54859.1|  559|Homo sapiens glycerol kinase protein.      54   6e-07
AJ252550-2|CAB54858.1|  553|Homo sapiens glycerol kinase protein.      54   6e-07
AJ252550-1|CAB54857.1|  524|Homo sapiens glycerol kinase protein.      54   6e-07
X78712-1|CAA55365.1|  553|Homo sapiens glycerol kinase protein.        52   2e-06
BC058888-1|AAH58888.1|  553|Homo sapiens glycerol kinase 2 protein.    52   2e-06
BC048274-1|AAH48274.2|  553|Homo sapiens glycerol kinase 2 protein.    52   2e-06
BC029820-1|AAH29820.1|  553|Homo sapiens glycerol kinase 2 protein.    52   2e-06
X68285-1|CAA48346.1|  436|Homo sapiens glycerol kinase protein.        36   0.12 
BC130379-1|AAI30380.1|  566|Homo sapiens insulinoma-associated 2...    36   0.12 
BC130377-1|AAI30378.1|  566|Homo sapiens insulinoma-associated 2...    36   0.12 
AK096639-1|BAC04830.1|  566|Homo sapiens protein ( Homo sapiens ...    36   0.12 
AF260323-1|AAK49393.1|  567|Homo sapiens insulinoma-associated p...    36   0.12 
AB037912-1|BAB69042.1|  566|Homo sapiens nbla-106 protein.             36   0.12 
L25941-1|AAA59495.1|  615|Homo sapiens integral nuclear envelope...    31   2.5  
L25931-1|AAA59494.1|  615|Homo sapiens lamin B receptor protein.       31   2.5  
BX119322-3|CAI22211.1|  575|Homo sapiens novel protein protein.        31   2.5  
BX119322-2|CAI22210.1|  463|Homo sapiens novel protein protein.        31   2.5  
BX119322-1|CAI22209.1|  551|Homo sapiens novel protein protein.        31   2.5  
BC020079-1|AAH20079.1|  615|Homo sapiens lamin B receptor protein.     31   2.5  
BC014947-1|AAH14947.1|  439|Homo sapiens hypothetical protein FL...    31   2.5  
AL713859-4|CAH71630.1|  575|Homo sapiens novel protein protein.        31   2.5  
AL713859-3|CAH71629.1|  463|Homo sapiens novel protein protein.        31   2.5  
AL713859-2|CAH71628.1|  551|Homo sapiens novel protein protein.        31   2.5  
AL713859-1|CAH71626.1|  252|Homo sapiens novel protein protein.        31   2.5  
AL390234-4|CAI18947.1|  575|Homo sapiens novel protein protein.        31   2.5  
AL390234-3|CAI18949.1|  463|Homo sapiens novel protein protein.        31   2.5  
AL390234-2|CAI18948.1|  551|Homo sapiens novel protein protein.        31   2.5  
AL390234-1|CAI18945.1|  252|Homo sapiens novel protein protein.        31   2.5  
AL035416-4|CAI22777.1|  575|Homo sapiens novel protein protein.        31   2.5  
AL035416-3|CAI22776.1|  463|Homo sapiens novel protein protein.        31   2.5  
AL035416-2|CAI22775.1|  551|Homo sapiens novel protein protein.        31   2.5  
AL035416-1|CAI22774.1|  252|Homo sapiens novel protein protein.        31   2.5  
AK222834-1|BAD96554.1|  615|Homo sapiens lamin B receptor varian...    31   2.5  
AK001848-1|BAA91940.1|  252|Homo sapiens protein ( Homo sapiens ...    31   2.5  
AB209514-1|BAD92751.1|  616|Homo sapiens lamin B receptor varian...    31   2.5  
AK127641-1|BAC87068.1|  529|Homo sapiens protein ( Homo sapiens ...    31   3.4  
AK090901-1|BAC03542.1|  250|Homo sapiens protein ( Homo sapiens ...    31   3.4  
BC128073-1|AAI28074.1|  349|Homo sapiens doublecortin domain con...    30   5.9  
BC066640-1|AAH66640.1| 1227|Homo sapiens congenital dyserythropo...    30   5.9  
BC052568-1|AAH52568.1| 1228|Homo sapiens CDAN1 protein protein.        30   5.9  
BC008334-1|AAH08334.1|  751|Homo sapiens Unknown (protein for IM...    30   5.9  
BC008333-1|AAH08333.1|  751|Homo sapiens Unknown (protein for IM...    30   5.9  
BC001092-1|AAH01092.1|  751|Homo sapiens CDAN1 protein protein.        30   5.9  
AY358467-1|AAQ88832.1|  280|Homo sapiens CDAN1 protein.                30   5.9  
AL645529-1|CAI14956.1|  458|Homo sapiens G protein regulated ind...    30   5.9  
AF525398-1|AAO14994.1| 1265|Homo sapiens codanin I protein.            30   5.9  
X12387-1|CAA30944.1|  503|Homo sapiens protein ( Human mRNA for ...    30   7.8  
M14096-1|AAA35744.1|  503|Homo sapiens protein ( Human cytochrom...    30   7.8  
M13785-1|AAA35742.1|  504|Homo sapiens protein ( Human liver glu...    30   7.8  
J04449-1|AAA35747.1|  502|Homo sapiens cytochrome P450 nifedipin...    30   7.8  
D00003-1|BAA00001.1|  504|Homo sapiens cytochrome P-450 protein.       30   7.8  
BC131820-1|AAI31821.1| 1976|Homo sapiens FRAS1 protein protein.        30   7.8  
BC064601-1|AAH64601.1|  583|Homo sapiens PLEKHA4 protein protein.      30   7.8  
BC064487-1|AAH64487.1|  651|Homo sapiens FRAS1 protein protein.        30   7.8  
BC052281-1|AAH52281.1|  651|Homo sapiens FRAS1 protein protein.        30   7.8  
BC024157-1|AAH24157.1|  779|Homo sapiens pleckstrin homology dom...    30   7.8  
BC011672-1|AAH11672.1|  461|Homo sapiens GPRIN2 protein protein.       30   7.8  
AY007233-1|AAG01896.1|  779|Homo sapiens phosphoinositol 3-phosp...    30   7.8  
AK027833-1|BAB55399.1|  441|Homo sapiens protein ( Homo sapiens ...    30   7.8  
AJ512501-1|CAD54734.1| 4007|Homo sapiens extracellular matrix pr...    30   7.8  
AB208908-1|BAD92145.1|  382|Homo sapiens Pleckstrin homology dom...    30   7.8  
AB011086-1|BAA25440.2|  483|Homo sapiens KIAA0514 protein protein.     30   7.8  

>X78711-1|CAA55364.1|  553|Homo sapiens glycerol kinase protein.
          Length = 553

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++PLM E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 435 MQLQADILYIPVVKPLMPETTALGAAMAAGAAEGVDVWSLEPEDLSAVTMERFEPQINAE 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 495 ESEIRYSTWKKAVMKSMGWVTTQS 518



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 395 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 434


>BC066960-1|AAH66960.1|  553|Homo sapiens GK3P protein protein.
          Length = 553

 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++PLM E+TALGAA+ AG A  + VW   P  + +     F P +   
Sbjct: 435 MQLQADILYIPVVKPLMPETTALGAAMAAGAAEGVDVWSLEPEDLSAVTMKRFEPQINAE 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 495 ESEIRYSTWKKAVMKSMGWVTTQS 518



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 395 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 434


>X69886-1|CAA49512.1|  395|Homo sapiens glycerol kinase protein.
          Length = 395

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 306 MQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAE 365

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 366 ESEIRYSTWKKAVMKSMGWVTTQS 389



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 266 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 305


>L13943-1|AAA52576.1|  524|Homo sapiens glycerol kinase protein.
          Length = 524

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 435 MQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAE 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 495 ESEIRYSTWKKAVMKSMGWVTTQS 518



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 395 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 434


>BC071595-1|AAH71595.1|  530|Homo sapiens glycerol kinase protein.
          Length = 530

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 441 MQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAE 500

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 501 ESEIRYSTWKKAVMKSMGWVTTQS 524



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 401 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 440


>BC042421-1|AAH42421.1|  530|Homo sapiens glycerol kinase protein.
          Length = 530

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 441 MQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAE 500

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 501 ESEIRYSTWKKAVMKSMGWVTTQS 524



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 401 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 440


>BC037549-1|AAH37549.1|  524|Homo sapiens glycerol kinase protein.
          Length = 524

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 435 MQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAE 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 495 ESEIRYSTWKKAVMKSMGWVTTQS 518



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 395 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 434


>AJ252550-3|CAB54859.1|  559|Homo sapiens glycerol kinase protein.
          Length = 559

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 441 MQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAE 500

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 501 ESEIRYSTWKKAVMKSMGWVTTQS 524



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 401 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 440


>AJ252550-2|CAB54858.1|  553|Homo sapiens glycerol kinase protein.
          Length = 553

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 435 MQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAE 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 495 ESEIRYSTWKKAVMKSMGWVTTQS 518



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 395 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 434


>AJ252550-1|CAB54857.1|  524|Homo sapiens glycerol kinase protein.
          Length = 524

 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPV++P M E+TALGAA+ AG A  + VW   P  + +   + F P +   
Sbjct: 435 MQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAE 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  T++
Sbjct: 495 ESEIRYSTWKKAVMKSMGWVTTQS 518



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 395 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 434


>X78712-1|CAA55365.1|  553|Homo sapiens glycerol kinase protein.
          Length = 553

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPVI+P M E+TALGAA+ AG A  + VW   P  +     + F P +   
Sbjct: 435 MQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQIQAT 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  +++
Sbjct: 495 ESEIRYATWKKAVMKSMGWVTSQS 518



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTRXXXXXXXXXXA-PLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PLR L  DGGM  N VL
Sbjct: 395 AALEAVCFQTREILEAMNRDCGIPLRHLQVDGGMTNNKVL 434


>BC058888-1|AAH58888.1|  553|Homo sapiens glycerol kinase 2 protein.
          Length = 553

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPVI+P M E+TALGAA+ AG A  + VW   P  +     + F P +   
Sbjct: 435 MQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQIQAT 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  +++
Sbjct: 495 ESEIRYATWKKAVMKSMGWVTSQS 518



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTRXXXXXXXXXXA-PLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PLR L  DGGM  N VL
Sbjct: 395 AALEAVCFQTREILEAMNRDCGIPLRHLQVDGGMTNNKVL 434


>BC048274-1|AAH48274.2|  553|Homo sapiens glycerol kinase 2 protein.
          Length = 553

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPVI+P M E+TALGAA+ AG A  + VW   P  +     + F P +   
Sbjct: 435 MQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQIQAT 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  +++
Sbjct: 495 ESEIRYATWKKAVMKSMGWVTSQS 518



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTRXXXXXXXXXXA-PLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PLR L  DGGM  N VL
Sbjct: 395 AALEAVCFQTREILEAMNRDCGIPLRHLQVDGGMTNNKVL 434


>BC029820-1|AAH29820.1|  553|Homo sapiens glycerol kinase 2 protein.
          Length = 553

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 5/84 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW---PTTIPSPPADTFLPALTNX 345
           +Q+QAD+L IPVI+P M E+TALGAA+ AG A  + VW   P  +     + F P +   
Sbjct: 435 MQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQIQAT 494

Query: 344 XXXXXXXXXXEALNKCMGWTDTKN 273
                     +A+ K MGW  +++
Sbjct: 495 ESEIRYATWKKAVMKSMGWVTSQS 518



 Score = 36.7 bits (81), Expect = 0.068
 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTRXXXXXXXXXXA-PLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PLR L  DGGM  N VL
Sbjct: 395 AALEAVCFQTREILEAMNRDCGIPLRHLQVDGGMTNNKVL 434


>X68285-1|CAA48346.1|  436|Homo sapiens glycerol kinase protein.
          Length = 436

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 15/24 (62%), Positives = 21/24 (87%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALG 438
           +Q+QAD+L IPV++P M E+TALG
Sbjct: 365 MQLQADILYIPVVKPSMPETTALG 388



 Score = 33.9 bits (74), Expect = 0.48
 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -1

Query: 625 AALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           AALEAVC QTR            PL  L  DGGM  N +L
Sbjct: 325 AALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKIL 364


>BC130379-1|AAI30380.1|  566|Homo sapiens insulinoma-associated 2
           protein.
          Length = 566

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 26/86 (30%), Positives = 38/86 (44%)
 Frame = -3

Query: 617 GGRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALG 438
           GGR   + R GGR+G     P  +P      A+ +  +++   L   +  P+  ES   G
Sbjct: 87  GGREGAEWRAGGREG-----PGPSPSPSPSPAKPAGAELRRAFLERCLSSPVSAESFPGG 141

Query: 437 AAIVAGRAMRVWPTTIPSPPADTFLP 360
           AA VA  +  V P   P+P     LP
Sbjct: 142 AAAVAAFSCSVAPAAAPTPGEQFLLP 167


>BC130377-1|AAI30378.1|  566|Homo sapiens insulinoma-associated 2
           protein.
          Length = 566

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 26/86 (30%), Positives = 38/86 (44%)
 Frame = -3

Query: 617 GGRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALG 438
           GGR   + R GGR+G     P  +P      A+ +  +++   L   +  P+  ES   G
Sbjct: 87  GGREGAEWRAGGREG-----PGPSPSPSPSPAKPAGAELRRAFLERCLSSPVSAESFPGG 141

Query: 437 AAIVAGRAMRVWPTTIPSPPADTFLP 360
           AA VA  +  V P   P+P     LP
Sbjct: 142 AAAVAAFSCSVAPAAAPTPGEQFLLP 167


>AK096639-1|BAC04830.1|  566|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39320 fis, clone OCBBF2014828, moderately
           similar to Mus musculus mlt 1 gene. ).
          Length = 566

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 26/86 (30%), Positives = 38/86 (44%)
 Frame = -3

Query: 617 GGRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALG 438
           GGR   + R GGR+G     P  +P      A+ +  +++   L   +  P+  ES   G
Sbjct: 87  GGREGAEWRAGGREG-----PGPSPSPSPSPAKPAGAELRRAFLERCLSSPVSAESFPGG 141

Query: 437 AAIVAGRAMRVWPTTIPSPPADTFLP 360
           AA VA  +  V P   P+P     LP
Sbjct: 142 AAAVAAFSCSVAPAAAPTPGEQFLLP 167


>AF260323-1|AAK49393.1|  567|Homo sapiens insulinoma-associated
           protein IA-6 protein.
          Length = 567

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/87 (34%), Positives = 39/87 (44%), Gaps = 1/87 (1%)
 Frame = -3

Query: 617 GGRVSPDARRGGRDGCRLRAPEATPRRRRD-GAELSSVQMQADLLGIPVIRPLMMESTAL 441
           GGR   + R GGR+G    +P  +P   +  GAEL   +  +  L  PV      ES   
Sbjct: 87  GGREGAEWRAGGREGPG-PSPSPSPSPAKPAGAELRRARSWSACLSSPV----SAESFPG 141

Query: 440 GAAIVAGRAMRVWPTTIPSPPADTFLP 360
           GAA VA  +  V P   P+P     LP
Sbjct: 142 GAAAVAAFSCSVAPAAAPTPGEQFLLP 168


>AB037912-1|BAB69042.1|  566|Homo sapiens nbla-106 protein.
          Length = 566

 Score = 35.9 bits (79), Expect = 0.12
 Identities = 26/86 (30%), Positives = 38/86 (44%)
 Frame = -3

Query: 617 GGRVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALG 438
           GGR   + R GGR+G     P  +P      A+ +  +++   L   +  P+  ES   G
Sbjct: 87  GGREGAEWRAGGREG-----PGPSPSPSPSPAKPAGAELRRAFLERCLSSPVSAESFPGG 141

Query: 437 AAIVAGRAMRVWPTTIPSPPADTFLP 360
           AA VA  +  V P   P+P     LP
Sbjct: 142 AAAVAAFSCSVAPAAAPTPGEQFLLP 167


>L25941-1|AAA59495.1|  615|Homo sapiens integral nuclear envelope
           inner membrane protein protein.
          Length = 615

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRA 597
           SS+PS RRRG  S +RS  P RPP+ A
Sbjct: 69  SSSPS-RRRGSRSRSRSRSPGRPPKSA 94


>L25931-1|AAA59494.1|  615|Homo sapiens lamin B receptor protein.
          Length = 615

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRA 597
           SS+PS RRRG  S +RS  P RPP+ A
Sbjct: 69  SSSPS-RRRGSRSRSRSRSPGRPPKSA 94


>BX119322-3|CAI22211.1|  575|Homo sapiens novel protein protein.
          Length = 575

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 489 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 520


>BX119322-2|CAI22210.1|  463|Homo sapiens novel protein protein.
          Length = 463

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 377 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 408


>BX119322-1|CAI22209.1|  551|Homo sapiens novel protein protein.
          Length = 551

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 465 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 496


>BC020079-1|AAH20079.1|  615|Homo sapiens lamin B receptor protein.
          Length = 615

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRA 597
           SS+PS RRRG  S +RS  P RPP+ A
Sbjct: 69  SSSPS-RRRGSRSRSRSRSPGRPPKSA 94


>BC014947-1|AAH14947.1|  439|Homo sapiens hypothetical protein
           FLJ10986 protein.
          Length = 439

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 353 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 384


>AL713859-4|CAH71630.1|  575|Homo sapiens novel protein protein.
          Length = 575

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 489 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 520


>AL713859-3|CAH71629.1|  463|Homo sapiens novel protein protein.
          Length = 463

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 377 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 408


>AL713859-2|CAH71628.1|  551|Homo sapiens novel protein protein.
          Length = 551

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 465 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 496


>AL713859-1|CAH71626.1|  252|Homo sapiens novel protein protein.
          Length = 252

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 166 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 197


>AL390234-4|CAI18947.1|  575|Homo sapiens novel protein protein.
          Length = 575

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 489 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 520


>AL390234-3|CAI18949.1|  463|Homo sapiens novel protein protein.
          Length = 463

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 377 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 408


>AL390234-2|CAI18948.1|  551|Homo sapiens novel protein protein.
          Length = 551

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 465 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 496


>AL390234-1|CAI18945.1|  252|Homo sapiens novel protein protein.
          Length = 252

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 166 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 197


>AL035416-4|CAI22777.1|  575|Homo sapiens novel protein protein.
          Length = 575

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 489 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 520


>AL035416-3|CAI22776.1|  463|Homo sapiens novel protein protein.
          Length = 463

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 377 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 408


>AL035416-2|CAI22775.1|  551|Homo sapiens novel protein protein.
          Length = 551

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 465 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 496


>AL035416-1|CAI22774.1|  252|Homo sapiens novel protein protein.
          Length = 252

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 166 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 197


>AK222834-1|BAD96554.1|  615|Homo sapiens lamin B receptor variant
           protein.
          Length = 615

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRA 597
           SS+PS RRRG  S +RS  P RPP+ A
Sbjct: 69  SSSPS-RRRGSRSRSRSRSPGRPPKSA 94


>AK001848-1|BAA91940.1|  252|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10986 fis, clone PLACE1001869, weakly similar to
           L-RIBULOKINASE (EC 2.7.1.16). ).
          Length = 252

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           VQM AD+ G+PV+    +ES  +GAA++   A
Sbjct: 166 VQMHADITGMPVVLSQEVESVLVGAAVLGACA 197


>AB209514-1|BAD92751.1|  616|Homo sapiens lamin B receptor variant
           protein.
          Length = 616

 Score = 31.5 bits (68), Expect = 2.5
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = +1

Query: 517 SSAPSLRRRGVASGARSLQPSRPPRRA 597
           SS+PS RRRG  S +RS  P RPP+ A
Sbjct: 70  SSSPS-RRRGSRSRSRSRSPGRPPKSA 95


>AK127641-1|BAC87068.1|  529|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45739 fis, clone KIDNE2010049, weakly  similar
           to Glycerol kinase 2 (EC 2.7.1.30). ).
          Length = 529

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +QM +DL+   + RP  ++ + LGAA +AG A+  W
Sbjct: 448 MQMTSDLINENIDRPADIDMSCLGAASLAGLAVGFW 483


>AK090901-1|BAC03542.1|  250|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33582 fis, clone BRAMY2011849, weakly similar to
           GLYCEROL KINASE 2 (EC 2.7.1.30). ).
          Length = 250

 Score = 31.1 bits (67), Expect = 3.4
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402
           +QM +DL+   + RP  ++ + LGAA +AG A+  W
Sbjct: 169 MQMTSDLINENIDRPADIDMSCLGAASLAGLAVGFW 204


>BC128073-1|AAI28074.1|  349|Homo sapiens doublecortin domain
           containing 2B protein.
          Length = 349

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 21/56 (37%), Positives = 25/56 (44%)
 Frame = -2

Query: 522 RTQFCADAG*FTGYTSHSSPHDGKYSPGGGHCRRSRNACVAHDNTQPTGRYIPAGS 355
           R Q+ A AG    +  H  PH GK  PGG  CR        H      GR +PAG+
Sbjct: 74  RGQYVA-AGFERFHKLHYLPHRGK-DPGGKSCRLQGPPVTRHLCDGAIGRQLPAGA 127


>BC066640-1|AAH66640.1| 1227|Homo sapiens congenital dyserythropoietic
            anemia, type I protein.
          Length = 1227

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +1

Query: 439  PRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
            P AVLS       G+ ++ AC     +    +RR   A+ +R+L+   P   A G+ R  
Sbjct: 954  PAAVLSSAENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGC 1013

Query: 619  AR 624
            +R
Sbjct: 1014 SR 1015


>BC052568-1|AAH52568.1| 1228|Homo sapiens CDAN1 protein protein.
          Length = 1228

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +1

Query: 439  PRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
            P AVLS       G+ ++ AC     +    +RR   A+ +R+L+   P   A G+ R  
Sbjct: 955  PAAVLSSAENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGC 1014

Query: 619  AR 624
            +R
Sbjct: 1015 SR 1016


>BC008334-1|AAH08334.1|  751|Homo sapiens Unknown (protein for
           IMAGE:3506174) protein.
          Length = 751

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +1

Query: 439 PRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
           P AVLS       G+ ++ AC     +    +RR   A+ +R+L+   P   A G+ R  
Sbjct: 478 PAAVLSSAENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGC 537

Query: 619 AR 624
           +R
Sbjct: 538 SR 539


>BC008333-1|AAH08333.1|  751|Homo sapiens Unknown (protein for
           IMAGE:3506145) protein.
          Length = 751

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +1

Query: 439 PRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
           P AVLS       G+ ++ AC     +    +RR   A+ +R+L+   P   A G+ R  
Sbjct: 478 PAAVLSSAENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGC 537

Query: 619 AR 624
           +R
Sbjct: 538 SR 539


>BC001092-1|AAH01092.1|  751|Homo sapiens CDAN1 protein protein.
          Length = 751

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +1

Query: 439 PRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
           P AVLS       G+ ++ AC     +    +RR   A+ +R+L+   P   A G+ R  
Sbjct: 478 PAAVLSSAENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGC 537

Query: 619 AR 624
           +R
Sbjct: 538 SR 539


>AY358467-1|AAQ88832.1|  280|Homo sapiens CDAN1 protein.
          Length = 280

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +1

Query: 439 PRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
           P AVLS       G+ ++ AC     +    +RR   A+ +R+L+   P   A G+ R  
Sbjct: 218 PAAVLSSAENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGC 277

Query: 619 AR 624
           +R
Sbjct: 278 SR 279


>AL645529-1|CAI14956.1|  458|Homo sapiens G protein regulated
           inducer of neurite outgrowth 2 protein.
          Length = 458

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = -3

Query: 587 GGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALGAAIV 426
           GG D CRLRAP A   +R     + S QM+    G    R   +  +ALG++ V
Sbjct: 102 GGSDLCRLRAPSAAAMQRSHSDLVRSTQMR----GHSGARKASLSCSALGSSPV 151


>AF525398-1|AAO14994.1| 1265|Homo sapiens codanin I protein.
          Length = 1265

 Score = 30.3 bits (65), Expect = 5.9
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +1

Query: 439  PRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRPP 618
            P AVLS       G+ ++ AC     +    +RR   A+ +R+L+   P   A G+ R  
Sbjct: 992  PAAVLSSAENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGC 1051

Query: 619  AR 624
            +R
Sbjct: 1052 SR 1053


>X12387-1|CAA30944.1|  503|Homo sapiens protein ( Human mRNA for
           cytochrome P-450 (cyp3 locus). ).
          Length = 503

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +2

Query: 365 GMYRPVGWVLSWATHAL-RDLRQWPPPGLYFP 457
           GM+ P GWV+   ++AL RD + W  P  + P
Sbjct: 385 GMFIPKGWVVMIPSYALHRDPKYWTEPEKFLP 416


>M14096-1|AAA35744.1|  503|Homo sapiens protein ( Human cytochrome
           P-450 nifedipine oxidase mRNA, complet cds. ).
          Length = 503

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +2

Query: 365 GMYRPVGWVLSWATHAL-RDLRQWPPPGLYFP 457
           GM+ P GWV+   ++AL RD + W  P  + P
Sbjct: 385 GMFIPKGWVVMIPSYALHRDPKYWTEPEKFLP 416


>M13785-1|AAA35742.1|  504|Homo sapiens protein ( Human liver
           glucocorticoid-inducible cytochrome P-450 (HLp) mRNA,
           complete cds. ).
          Length = 504

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +2

Query: 365 GMYRPVGWVLSWATHAL-RDLRQWPPPGLYFP 457
           GM+ P GWV+   ++AL RD + W  P  + P
Sbjct: 386 GMFIPKGWVVMIPSYALHRDPKYWTEPEKFLP 417


>J04449-1|AAA35747.1|  502|Homo sapiens cytochrome P450 nifedipine
           oxidase protein.
          Length = 502

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +2

Query: 365 GMYRPVGWVLSWATHAL-RDLRQWPPPGLYFP 457
           GM+ P GWV+   ++AL RD + W  P  + P
Sbjct: 384 GMFIPKGWVVMIPSYALHRDPKYWTEPEKFLP 415


>D00003-1|BAA00001.1|  504|Homo sapiens cytochrome P-450 protein.
          Length = 504

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +2

Query: 365 GMYRPVGWVLSWATHAL-RDLRQWPPPGLYFP 457
           GM+ P GWV+   ++AL RD + W  P  + P
Sbjct: 386 GMFIPKGWVVMIPSYALHRDPKYWTEPEKFLP 417


>BC131820-1|AAI31821.1| 1976|Homo sapiens FRAS1 protein protein.
          Length = 1976

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 4/38 (10%)
 Frame = +3

Query: 351 GKSRQECIGRW----AGYCRGPHTHCATCDNGRPQGCT 452
           GK   EC G +     G C+  H  CA+C    P  CT
Sbjct: 587 GKCMSECPGGYYADATGRCKVCHNSCASCSGPTPSHCT 624


>BC064601-1|AAH64601.1|  583|Homo sapiens PLEKHA4 protein protein.
          Length = 583

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 12/18 (66%), Positives = 13/18 (72%)
 Frame = +1

Query: 574 PSRPPRRASGDTRPPARP 627
           P+R P   SGDT PPARP
Sbjct: 252 PARRPPAPSGDTAPPARP 269


>BC064487-1|AAH64487.1|  651|Homo sapiens FRAS1 protein protein.
          Length = 651

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 4/38 (10%)
 Frame = +3

Query: 351 GKSRQECIGRW----AGYCRGPHTHCATCDNGRPQGCT 452
           GK   EC G +     G C+  H  CA+C    P  CT
Sbjct: 429 GKCMSECPGGYYADATGRCKVCHNSCASCSGPTPSHCT 466


>BC052281-1|AAH52281.1|  651|Homo sapiens FRAS1 protein protein.
          Length = 651

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 4/38 (10%)
 Frame = +3

Query: 351 GKSRQECIGRW----AGYCRGPHTHCATCDNGRPQGCT 452
           GK   EC G +     G C+  H  CA+C    P  CT
Sbjct: 429 GKCMSECPGGYYADATGRCKVCHNSCASCSGPTPSHCT 466


>BC024157-1|AAH24157.1|  779|Homo sapiens pleckstrin homology domain
           containing, family A (phosphoinositide binding speci
           protein.
          Length = 779

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 12/18 (66%), Positives = 13/18 (72%)
 Frame = +1

Query: 574 PSRPPRRASGDTRPPARP 627
           P+R P   SGDT PPARP
Sbjct: 252 PARRPPAPSGDTAPPARP 269


>BC011672-1|AAH11672.1|  461|Homo sapiens GPRIN2 protein protein.
          Length = 461

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = -3

Query: 587 GGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALGAAIV 426
           GG D CRLRAP A   +R     + S QM+    G    R   +  +ALG++ V
Sbjct: 102 GGGDLCRLRAPSAAAMQRSHSDLVRSTQMR----GHSGARKASLSCSALGSSPV 151


>AY007233-1|AAG01896.1|  779|Homo sapiens phosphoinositol
           3-phosphate binding protein-1 protein.
          Length = 779

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 12/18 (66%), Positives = 13/18 (72%)
 Frame = +1

Query: 574 PSRPPRRASGDTRPPARP 627
           P+R P   SGDT PPARP
Sbjct: 252 PARRPPAPSGDTAPPARP 269


>AK027833-1|BAB55399.1|  441|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14927 fis, clone PLACE1009094, weakly similar to
           FURIN-LIKE PROTEASE 2 PRECURSOR (EC 3.4.21.75). ).
          Length = 441

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 4/38 (10%)
 Frame = +3

Query: 351 GKSRQECIGRW----AGYCRGPHTHCATCDNGRPQGCT 452
           GK   EC G +     G C+  H  CA+C    P  CT
Sbjct: 291 GKCMSECPGGYYADATGRCKVCHNSCASCSGPTPSHCT 328


>AJ512501-1|CAD54734.1| 4007|Homo sapiens extracellular matrix
           protein protein.
          Length = 4007

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 4/38 (10%)
 Frame = +3

Query: 351 GKSRQECIGRW----AGYCRGPHTHCATCDNGRPQGCT 452
           GK   EC G +     G C+  H  CA+C    P  CT
Sbjct: 587 GKCMSECPGGYYADATGRCKVCHNSCASCSGPTPSHCT 624


>AB208908-1|BAD92145.1|  382|Homo sapiens Pleckstrin homology
           domain-containing protein family A member 4 variant
           protein.
          Length = 382

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 12/18 (66%), Positives = 13/18 (72%)
 Frame = +1

Query: 574 PSRPPRRASGDTRPPARP 627
           P+R P   SGDT PPARP
Sbjct: 222 PARRPPAPSGDTAPPARP 239


>AB011086-1|BAA25440.2|  483|Homo sapiens KIAA0514 protein protein.
          Length = 483

 Score = 29.9 bits (64), Expect = 7.8
 Identities = 20/54 (37%), Positives = 27/54 (50%)
 Frame = -3

Query: 587 GGRDGCRLRAPEATPRRRRDGAELSSVQMQADLLGIPVIRPLMMESTALGAAIV 426
           GG D CRLRAP A   +R     + S QM+    G    R   +  +ALG++ V
Sbjct: 124 GGGDLCRLRAPSAAAMQRSHSDLVRSTQMR----GHSGARKASLSCSALGSSPV 173


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 94,933,672
Number of Sequences: 237096
Number of extensions: 2317065
Number of successful extensions: 6285
Number of sequences better than 10.0: 69
Number of HSP's better than 10.0 without gapping: 5728
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6244
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6860268620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -