SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30090.Seq
         (437 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z49148-1|CAA89008.1|  159|Homo sapiens ribosomal protein L29 pro...    52   7e-07
U49083-1|AAC50647.1|  159|Homo sapiens HIP protein.                    52   7e-07
U10248-1|AAC50499.1|  159|Homo sapiens ribosomal protein L29 pro...    52   7e-07
BC071909-1|AAH71909.1|  161|Homo sapiens ribosomal protein L29 p...    52   7e-07
BC071663-1|AAH71663.1|  159|Homo sapiens ribosomal protein L29 p...    52   7e-07
BC070481-1|AAH70481.1|  159|Homo sapiens ribosomal protein L29 p...    52   7e-07
BC070190-1|AAH70190.1|  159|Homo sapiens ribosomal protein L29 p...    52   7e-07
BC008926-1|AAH08926.1|  159|Homo sapiens ribosomal protein L29 p...    52   7e-07
AL450405-1|CAI16223.1|  172|Homo sapiens protein ( Human DNA seq...    52   7e-07

>Z49148-1|CAA89008.1|  159|Homo sapiens ribosomal protein L29
           protein.
          Length = 159

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>U49083-1|AAC50647.1|  159|Homo sapiens HIP protein.
          Length = 159

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>U10248-1|AAC50499.1|  159|Homo sapiens ribosomal protein L29
           protein.
          Length = 159

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>BC071909-1|AAH71909.1|  161|Homo sapiens ribosomal protein L29
           protein.
          Length = 161

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>BC071663-1|AAH71663.1|  159|Homo sapiens ribosomal protein L29
           protein.
          Length = 159

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>BC070481-1|AAH70481.1|  159|Homo sapiens ribosomal protein L29
           protein.
          Length = 159

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>BC070190-1|AAH70190.1|  159|Homo sapiens ribosomal protein L29
           protein.
          Length = 159

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>BC008926-1|AAH08926.1|  159|Homo sapiens ribosomal protein L29
           protein.
          Length = 159

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 1   MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 30



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 13  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57


>AL450405-1|CAI16223.1|  172|Homo sapiens protein ( Human DNA
           sequence from clone RP11-632C17 on chromosome 6 Contains
            the gene for a novel protein similar to ribosomal
           protein L29  ).
          Length = 172

 Score = 52.4 bits (120), Expect = 7e-07
 Identities = 22/30 (73%), Positives = 24/30 (80%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHE 254
           MAK  NHT HNQ+RK HRNGIKKPR  R+E
Sbjct: 16  MAKSKNHTTHNQSRKWHRNGIKKPRSQRYE 45



 Score = 39.9 bits (89), Expect = 0.004
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 4/45 (8%)
 Frame = +2

Query: 212 SQKWYQ----KAKEDQARTTLGMDPKFLRNQRFCKKGNLKPAKQL 334
           S+KW++    K +  +  +  G+DPKFLRN RF KK N K  K++
Sbjct: 28  SRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 72


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 50,984,883
Number of Sequences: 237096
Number of extensions: 834049
Number of successful extensions: 1720
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1624
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1720
length of database: 76,859,062
effective HSP length: 83
effective length of database: 57,180,094
effective search space used: 3545165828
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -