SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30059.Seq
         (702 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC040695-1|AAH40695.1|  358|Homo sapiens WBSCR16 protein protein.      60   8e-09
BC032712-1|AAH32712.1|  454|Homo sapiens WBSCR16 protein protein.      60   8e-09
BC019008-1|AAH19008.1|  464|Homo sapiens Williams-Beuren syndrom...    60   8e-09
BC007823-1|AAH07823.1|  464|Homo sapiens Williams-Beuren syndrom...    60   8e-09
AF410455-1|AAM62304.1|  464|Homo sapiens RCC1-like G exchanging ...    60   8e-09
AY284025-1|AAP32531.1|  312|Homo sapiens putative olfactory rece...    30   9.2  
AY284005-1|AAP32511.1|  312|Homo sapiens putative olfactory rece...    30   9.2  

>BC040695-1|AAH40695.1|  358|Homo sapiens WBSCR16 protein protein.
          Length = 358

 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 6/107 (5%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHFTTRNXP--LELLLSYAPIYIP 559
            S KT++  KV+G G+N DSQ+G+H + ++     E +L  +P+ +P
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLP 167


>BC032712-1|AAH32712.1|  454|Homo sapiens WBSCR16 protein protein.
          Length = 454

 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 6/107 (5%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHFTTRNXP--LELLLSYAPIYIP 559
            S KT++  KV+G G+N DSQ+G+H + ++     E +L  +P+ +P
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLP 167


>BC019008-1|AAH19008.1|  464|Homo sapiens Williams-Beuren syndrome
           chromosome region 16 protein.
          Length = 464

 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 6/107 (5%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHFTTRNXP--LELLLSYAPIYIP 559
            S KT++  KV+G G+N DSQ+G+H + ++     E +L  +P+ +P
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLP 167


>BC007823-1|AAH07823.1|  464|Homo sapiens Williams-Beuren syndrome
           chromosome region 16 protein.
          Length = 464

 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 6/107 (5%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHFTTRNXP--LELLLSYAPIYIP 559
            S KT++  KV+G G+N DSQ+G+H + ++     E +L  +P+ +P
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLP 167


>AF410455-1|AAM62304.1|  464|Homo sapiens RCC1-like G exchanging
           factor-like protein protein.
          Length = 464

 Score = 60.1 bits (139), Expect = 8e-09
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 6/107 (5%)
 Frame = +2

Query: 257 VWGFAETGALGIH---LPRXXXXXXXXXXXXXLVWH-PMRSSFAERFDITNIACGYGFTV 424
           VWGF+ +GALG+    +P               +   P R    ++  I++ ACGYGFT+
Sbjct: 63  VWGFSFSGALGVPSFVVPSSGPGPRAGARPRRRIQPVPYRLELDQK--ISSAACGYGFTL 120

Query: 425 ASIKTSEQHKVFGTGINTDSQIGYHFTTRNXP--LELLLSYAPIYIP 559
            S KT++  KV+G G+N DSQ+G+H + ++     E +L  +P+ +P
Sbjct: 121 LSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLP 167


>AY284025-1|AAP32531.1|  312|Homo sapiens putative olfactory
           receptor protein.
          Length = 312

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = +3

Query: 60  LFFXCGMLGNLINMYAAKFLIHRRSPV-FLLNRVSI 164
           LF+   M+GNL+ ++      H  SP+ FLL  +SI
Sbjct: 33  LFYFASMMGNLVTVFTVTMDAHLHSPMYFLLANLSI 68


>AY284005-1|AAP32511.1|  312|Homo sapiens putative olfactory
           receptor protein.
          Length = 312

 Score = 29.9 bits (64), Expect = 9.2
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = +3

Query: 60  LFFXCGMLGNLINMYAAKFLIHRRSPV-FLLNRVSI 164
           LF+   M+GNL+ ++      H  SP+ FLL  +SI
Sbjct: 33  LFYFASMMGNLVTVFTVTMDAHLHSPMYFLLANLSI 68


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,444,636
Number of Sequences: 237096
Number of extensions: 2101480
Number of successful extensions: 3438
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 3373
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3438
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8119219030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -