SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30054.Seq
         (765 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC018788-1|AAH18788.1|  308|Homo sapiens HABP4 protein protein.        35   0.28 
AL133477-5|CAI39621.1|  308|Homo sapiens hyaluronan binding prot...    35   0.28 
AL133477-4|CAI39620.1|  413|Homo sapiens hyaluronan binding prot...    35   0.28 
AF241831-1|AAF62546.1|  413|Homo sapiens intracellular hyalurona...    35   0.28 
CR457383-1|CAG33664.1|  387|Homo sapiens PAI-RBP1 protein.             33   0.85 
BC026916-1|AAH26916.1|  408|Homo sapiens SERPINE1 mRNA binding p...    33   0.85 
BC020555-1|AAH20555.1|  402|Homo sapiens SERPINE1 mRNA binding p...    33   0.85 
BC019273-1|AAH19273.1|  408|Homo sapiens SERPINE1 mRNA binding p...    33   0.85 
BC017449-1|AAH17449.1|  387|Homo sapiens SERPINE1 mRNA binding p...    33   0.85 
BC008045-1|AAH08045.1|  408|Homo sapiens SERPINE1 mRNA binding p...    33   0.85 
BC003049-1|AAH03049.1|  408|Homo sapiens SERPINE1 mRNA binding p...    33   0.85 
BC002488-1|AAH02488.1|  402|Homo sapiens SERPINE1 mRNA binding p...    33   0.85 
AL590559-4|CAH73325.1|  387|Homo sapiens PAI-1 mRNA-binding prot...    33   0.85 
AL590559-3|CAH73323.1|  408|Homo sapiens PAI-1 mRNA-binding prot...    33   0.85 
AL590559-2|CAH73324.1|  402|Homo sapiens PAI-1 mRNA-binding prot...    33   0.85 
AL590559-1|CAH73326.1|  393|Homo sapiens PAI-1 mRNA-binding prot...    33   0.85 
AK223138-1|BAD96858.1|  387|Homo sapiens PAI-1 mRNA-binding prot...    33   0.85 
AK222955-1|BAD96675.1|  387|Homo sapiens PAI-1 mRNA-binding prot...    33   0.85 
AK074970-1|BAC11324.1|  408|Homo sapiens protein ( Homo sapiens ...    33   0.85 
AF151813-1|AAD34050.1|  393|Homo sapiens CGI-55 protein protein.       33   0.85 

>BC018788-1|AAH18788.1|  308|Homo sapiens HABP4 protein protein.
          Length = 308

 Score = 35.1 bits (77), Expect = 0.28
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           M+ S+G    NR+   LDDE+DP D L+  E+ +
Sbjct: 16  MQESFGCVVANRFHQLLDDESDPFDILREAERRR 49


>AL133477-5|CAI39621.1|  308|Homo sapiens hyaluronan binding protein
           4 protein.
          Length = 308

 Score = 35.1 bits (77), Expect = 0.28
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           M+ S+G    NR+   LDDE+DP D L+  E+ +
Sbjct: 16  MQESFGCVVANRFHQLLDDESDPFDILREAERRR 49


>AL133477-4|CAI39620.1|  413|Homo sapiens hyaluronan binding protein
           4 protein.
          Length = 413

 Score = 35.1 bits (77), Expect = 0.28
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           M+ S+G    NR+   LDDE+DP D L+  E+ +
Sbjct: 16  MQESFGCVVANRFHQLLDDESDPFDILREAERRR 49


>AF241831-1|AAF62546.1|  413|Homo sapiens intracellular
           hyaluronan-binding protein protein.
          Length = 413

 Score = 35.1 bits (77), Expect = 0.28
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           M+ S+G    NR+   LDDE+DP D L+  E+ +
Sbjct: 16  MQESFGCVVANRFHQLLDDESDPFDILREAERRR 49


>CR457383-1|CAG33664.1|  387|Homo sapiens PAI-RBP1 protein.
          Length = 387

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>BC026916-1|AAH26916.1|  408|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 408

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>BC020555-1|AAH20555.1|  402|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 402

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>BC019273-1|AAH19273.1|  408|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 408

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>BC017449-1|AAH17449.1|  387|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 387

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>BC008045-1|AAH08045.1|  408|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 408

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>BC003049-1|AAH03049.1|  408|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 408

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>BC002488-1|AAH02488.1|  402|Homo sapiens SERPINE1 mRNA binding
           protein 1 protein.
          Length = 402

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>AL590559-4|CAH73325.1|  387|Homo sapiens PAI-1 mRNA-binding protein
           (PAI-RBP1) protein.
          Length = 387

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>AL590559-3|CAH73323.1|  408|Homo sapiens PAI-1 mRNA-binding protein
           (PAI-RBP1) protein.
          Length = 408

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>AL590559-2|CAH73324.1|  402|Homo sapiens PAI-1 mRNA-binding protein
           (PAI-RBP1) protein.
          Length = 402

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>AL590559-1|CAH73326.1|  393|Homo sapiens PAI-1 mRNA-binding protein
           (PAI-RBP1) protein.
          Length = 393

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>AK223138-1|BAD96858.1|  387|Homo sapiens PAI-1 mRNA-binding protein
           variant protein.
          Length = 387

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>AK222955-1|BAD96675.1|  387|Homo sapiens PAI-1 mRNA-binding protein
           variant protein.
          Length = 387

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>AK074970-1|BAC11324.1|  408|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90489 fis, clone NT2RP3003473, moderately
           similar to PAI-1 mRNA-binding protein. ).
          Length = 408

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


>AF151813-1|AAD34050.1|  393|Homo sapiens CGI-55 protein protein.
          Length = 393

 Score = 33.5 bits (73), Expect = 0.85
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +1

Query: 124 MENSYGVGXVNRYAXFLDDETDPLDALKAREQAK 225
           ++  +G    NR+    DDE+DP + LKA E  K
Sbjct: 5   LQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKK 38


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,108,079
Number of Sequences: 237096
Number of extensions: 1234997
Number of successful extensions: 1650
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 1591
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1650
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9199990470
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -