SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D26488-1|BAA05499.1|  686|Homo sapiens KIAA0007 protein.               34   0.54 
Y08999-1|CAA70203.1|  370|Homo sapiens Sop2p-like protein protein.     31   3.8  
BC054027-1|AAH54027.1|  370|Homo sapiens actin related protein 2...    31   3.8  
BC047889-1|AAH47889.2|  370|Homo sapiens actin related protein 2...    31   3.8  
BC039594-1|AAH39594.2|  370|Homo sapiens actin related protein 2...    31   3.8  
AK223015-1|BAD96735.1|  365|Homo sapiens actin related protein 2...    31   3.8  
AC004834-1|AAS00381.1|  166|Homo sapiens unknown protein.              31   3.8  
AB209059-1|BAD92296.1|  401|Homo sapiens actin related protein 2...    31   3.8  

>D26488-1|BAA05499.1|  686|Homo sapiens KIAA0007 protein.
          Length = 686

 Score = 34.3 bits (75), Expect = 0.54
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = +1

Query: 304 KVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVK 402
           +V  + W +  G LYSC+ D  + EWN++   VK
Sbjct: 137 RVNCIQWHQDSGCLYSCSDDKHIVEWNVQTCKVK 170


>Y08999-1|CAA70203.1|  370|Homo sapiens Sop2p-like protein protein.
          Length = 370

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +1

Query: 277 WVPA---KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQT 408
           WV A   K  +  +T +DW+ K   + +C  D   Y W+ +DG  K T
Sbjct: 42  WVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPT 89


>BC054027-1|AAH54027.1|  370|Homo sapiens actin related protein 2/3
           complex, subunit 1A, 41kDa protein.
          Length = 370

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +1

Query: 277 WVPA---KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQT 408
           WV A   K  +  +T +DW+ K   + +C  D   Y W+ +DG  K T
Sbjct: 42  WVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPT 89


>BC047889-1|AAH47889.2|  370|Homo sapiens actin related protein 2/3
           complex, subunit 1A, 41kDa protein.
          Length = 370

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +1

Query: 277 WVPA---KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQT 408
           WV A   K  +  +T +DW+ K   + +C  D   Y W+ +DG  K T
Sbjct: 42  WVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPT 89


>BC039594-1|AAH39594.2|  370|Homo sapiens actin related protein 2/3
           complex, subunit 1A, 41kDa protein.
          Length = 370

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +1

Query: 277 WVPA---KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQT 408
           WV A   K  +  +T +DW+ K   + +C  D   Y W+ +DG  K T
Sbjct: 42  WVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPT 89


>AK223015-1|BAD96735.1|  365|Homo sapiens actin related protein 2/3
           complex subunit 1A variant protein.
          Length = 365

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +1

Query: 277 WVPA---KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQT 408
           WV A   K  +  +T +DW+ K   + +C  D   Y W+ +DG  K T
Sbjct: 37  WVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPT 84


>AC004834-1|AAS00381.1|  166|Homo sapiens unknown protein.
          Length = 166

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +1

Query: 277 WVPA---KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQT 408
           WV A   K  +  +T +DW+ K   + +C  D   Y W+ +DG  K T
Sbjct: 42  WVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPT 89


>AB209059-1|BAD92296.1|  401|Homo sapiens actin related protein 2/3
           complex subunit 1A variant protein.
          Length = 401

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +1

Query: 277 WVPA---KHFSAKVTALDWSRKYG-LYSCTKDSRVYEWNIEDGSVKQT 408
           WV A   K  +  +T +DW+ K   + +C  D   Y W+ +DG  K T
Sbjct: 73  WVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPT 120


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,312,145
Number of Sequences: 237096
Number of extensions: 2246888
Number of successful extensions: 3718
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 3536
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3717
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10315140830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -