SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S35960-1|AAB22173.1|  153|Homo sapiens laminin receptor homolog ...   151   1e-36
S64169-1|AAB27665.1|  214|Homo sapiens QM protein.                    151   3e-36
M81806-1|AAA36021.1|  214|Homo sapiens protein ( Human housekeep...   151   3e-36
M73791-1|AAA36378.1|  214|Homo sapiens protein ( Human novel gen...   151   3e-36
M64241-1|AAA63253.1|  214|Homo sapiens Wilm's tumor-related prot...   151   3e-36
L44140-3|AAA92646.1|  214|Homo sapiens QM protein.                    151   3e-36
DQ369716-1|ABC88572.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369715-1|ABC88571.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369714-1|ABC88570.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369713-1|ABC88569.1|  214|Homo sapiens QM protein isoform 1 pr...   151   3e-36
DQ369712-1|ABC88568.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369711-1|ABC88567.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369710-1|ABC88566.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369709-1|ABC88565.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369708-1|ABC88564.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369707-1|ABC88563.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369706-1|ABC88562.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369705-1|ABC88561.1|  214|Homo sapiens QM protein protein.          151   3e-36
DQ369704-1|ABC88560.1|  214|Homo sapiens QM protein isoform 2 pr...   151   3e-36
DQ369703-1|ABC88559.1|  214|Homo sapiens QM protein protein.          151   3e-36
CR542069-1|CAG46866.1|  214|Homo sapiens RPL10 protein.               151   3e-36
CR456797-1|CAG33078.1|  214|Homo sapiens RPL10 protein.               151   3e-36
BX936347-16|CAO72117.1|  181|Homo sapiens ribosomal protein L10 ...   151   3e-36
BX936347-15|CAI43214.1|  214|Homo sapiens ribosomal protein L10 ...   151   3e-36
BX936347-14|CAM45852.1|  201|Homo sapiens ribosomal protein L10 ...   151   3e-36
BX936346-8|CAO03567.1|  181|Homo sapiens ribosomal protein L10 p...   151   3e-36
BX936346-7|CAI43230.1|  214|Homo sapiens ribosomal protein L10 p...   151   3e-36
BX936346-6|CAM45853.1|  201|Homo sapiens ribosomal protein L10 p...   151   3e-36
BC071918-1|AAH71918.1|  214|Homo sapiens ribosomal protein L10 p...   151   3e-36
BC026276-1|AAH26276.1|  214|Homo sapiens ribosomal protein L10 p...   151   3e-36
BC003358-1|AAH03358.1|  214|Homo sapiens ribosomal protein L10 p...   151   3e-36
AK223309-1|BAD97029.1|  214|Homo sapiens ribosomal protein L10 v...   151   3e-36
AF486812-1|AAL88713.1|  213|Homo sapiens ribosomal protein L10 p...   146   4e-35
BC066312-1|AAH66312.1|  214|Homo sapiens ribosomal protein L10-l...   144   2e-34
BC014310-1|AAH14310.1|  214|Homo sapiens ribosomal protein L10-l...   144   2e-34
AB063608-1|BAC19835.1|  214|Homo sapiens ribosomal protein L10-l...   144   2e-34
BX936347-17|CAI43215.1|  230|Homo sapiens ribosomal protein L10 ...   138   1e-32
BX936346-9|CAI43231.1|  230|Homo sapiens ribosomal protein L10 p...   138   1e-32
AB063605-1|BAC19833.1|   36|Homo sapiens ribosomal protein L10-l...    68   3e-11
AB007170-1|BAA28595.1|   80|Homo sapiens ribosomal protein L10 p...    33   0.83 

>S35960-1|AAB22173.1|  153|Homo sapiens laminin receptor homolog
           protein.
          Length = 153

 Score =  151 bits (367), Expect = 1e-36
 Identities = 80/146 (54%), Positives = 92/146 (63%), Gaps = 3/146 (2%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 10  RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 69

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR---*DFTLSTLSASIKCYHALELIXSRLGCVVRLA 351
           ALEA RIC N Y+VK+CG D FHIR     F +  ++  + C  A  L     G      
Sbjct: 70  ALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGA---FG 126

Query: 352 SLRVL*HVFALDXXSCPCGSSDRWKA 429
             + L   F L   SCP   S R ++
Sbjct: 127 KPQALWPGFTLAKLSCPSAPSCRTRS 152


>S64169-1|AAB27665.1|  214|Homo sapiens QM protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>M81806-1|AAA36021.1|  214|Homo sapiens protein ( Human housekeeping
           (Q1Z 7F5) gene, exons 2 through 7, complete cds. ).
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>M73791-1|AAA36378.1|  214|Homo sapiens protein ( Human novel gene
           mRNA, complete cds. ).
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>M64241-1|AAA63253.1|  214|Homo sapiens Wilm's tumor-related protein
           protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>L44140-3|AAA92646.1|  214|Homo sapiens QM protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369716-1|ABC88572.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369715-1|ABC88571.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369714-1|ABC88570.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369713-1|ABC88569.1|  214|Homo sapiens QM protein isoform 1
           protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369712-1|ABC88568.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369711-1|ABC88567.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369710-1|ABC88566.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369709-1|ABC88565.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369708-1|ABC88564.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369707-1|ABC88563.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369706-1|ABC88562.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369705-1|ABC88561.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369704-1|ABC88560.1|  214|Homo sapiens QM protein isoform 2
           protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>DQ369703-1|ABC88559.1|  214|Homo sapiens QM protein protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>CR542069-1|CAG46866.1|  214|Homo sapiens RPL10 protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>CR456797-1|CAG33078.1|  214|Homo sapiens RPL10 protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BX936347-16|CAO72117.1|  181|Homo sapiens ribosomal protein L10
           protein.
          Length = 181

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 20/21 (95%), Positives = 21/21 (100%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGAD 317
           +RLHPFHVIRINKMLSCAGAD
Sbjct: 89  VRLHPFHVIRINKMLSCAGAD 109


>BX936347-15|CAI43214.1|  214|Homo sapiens ribosomal protein L10
           protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BX936347-14|CAM45852.1|  201|Homo sapiens ribosomal protein L10
           protein.
          Length = 201

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BX936346-8|CAO03567.1|  181|Homo sapiens ribosomal protein L10
           protein.
          Length = 181

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 20/21 (95%), Positives = 21/21 (100%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGAD 317
           +RLHPFHVIRINKMLSCAGAD
Sbjct: 89  VRLHPFHVIRINKMLSCAGAD 109


>BX936346-7|CAI43230.1|  214|Homo sapiens ribosomal protein L10
           protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BX936346-6|CAM45853.1|  201|Homo sapiens ribosomal protein L10
           protein.
          Length = 201

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BC071918-1|AAH71918.1|  214|Homo sapiens ribosomal protein L10
           protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BC026276-1|AAH26276.1|  214|Homo sapiens ribosomal protein L10
           protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BC003358-1|AAH03358.1|  214|Homo sapiens ribosomal protein L10
           protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>AK223309-1|BAD97029.1|  214|Homo sapiens ribosomal protein L10
           variant protein.
          Length = 214

 Score =  151 bits (365), Expect = 3e-36
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 64  ALEAARICANKYMVKSCGKDGFHIR 88



 Score =  115 bits (276), Expect = 2e-25
 Identities = 61/95 (64%), Positives = 68/95 (71%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A      KFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKLKFPGRQKIHISKKWGFTKFNADEF 181


>AF486812-1|AAL88713.1|  213|Homo sapiens ribosomal protein L10
           protein.
          Length = 213

 Score =  146 bits (355), Expect = 4e-35
 Identities = 67/85 (78%), Positives = 72/85 (84%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRF-RGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSE 62

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FHIR
Sbjct: 63  ALEAARICANKYMVKSCGKDGFHIR 87



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 88  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 145

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 146 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 180


>BC066312-1|AAH66312.1|  214|Homo sapiens ribosomal protein L10-like
           protein.
          Length = 214

 Score =  144 bits (350), Expect = 2e-34
 Identities = 65/85 (76%), Positives = 71/85 (83%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPL  H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FH+R
Sbjct: 64  ALEAARICANKYMVKSCGRDGFHMR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNEE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BC014310-1|AAH14310.1|  214|Homo sapiens ribosomal protein L10-like
           protein.
          Length = 214

 Score =  144 bits (350), Expect = 2e-34
 Identities = 65/85 (76%), Positives = 71/85 (83%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPL  H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FH+R
Sbjct: 64  ALEAARICANKYMVKSCGRDGFHMR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNEE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>AB063608-1|BAC19835.1|  214|Homo sapiens ribosomal protein L10-like
           protein.
          Length = 214

 Score =  144 bits (350), Expect = 2e-34
 Identities = 65/85 (76%), Positives = 71/85 (83%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPL  H+VSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLGGHMVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR 255
           ALEA RIC N Y+VK+CG D FH+R
Sbjct: 64  ALEAARICANKYMVKSCGRDGFHMR 88



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 89  VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNEE 146

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 147 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 181


>BX936347-17|CAI43215.1|  230|Homo sapiens ribosomal protein L10
           protein.
          Length = 230

 Score =  138 bits (335), Expect = 1e-32
 Identities = 62/80 (77%), Positives = 67/80 (83%)
 Frame = +1

Query: 16  YRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSEALEAG 195
           YRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSEALEA 
Sbjct: 25  YRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAA 84

Query: 196 RICCNXYLVKNCGXDQFHIR 255
           RIC N Y+VK+CG D FHIR
Sbjct: 85  RICANKYMVKSCGKDGFHIR 104



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 105 VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 162

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 163 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 197


>BX936346-9|CAI43231.1|  230|Homo sapiens ribosomal protein L10
           protein.
          Length = 230

 Score =  138 bits (335), Expect = 1e-32
 Identities = 62/80 (77%), Positives = 67/80 (83%)
 Frame = +1

Query: 16  YRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSEALEAG 195
           YRY KNKPYPKSR  RGVPD KIRIFDLG+  A VD+FPLC H+VSDEYEQLSSEALEA 
Sbjct: 25  YRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAA 84

Query: 196 RICCNXYLVKNCGXDQFHIR 255
           RIC N Y+VK+CG D FHIR
Sbjct: 85  RICANKYMVKSCGKDGFHIR 104



 Score =  117 bits (282), Expect = 3e-26
 Identities = 62/95 (65%), Positives = 69/95 (72%), Gaps = 1/95 (1%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           +RLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARV IGQ IMS+R   +++   
Sbjct: 105 VRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRT--KLQNKE 162

Query: 435 HRGSA-PSPSFKFPGRAKDLRIKEVGFTKYERDEF 536
           H   A     FKFPGR K    K+ GFTK+  DEF
Sbjct: 163 HVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEF 197


>AB063605-1|BAC19833.1|   36|Homo sapiens ribosomal protein L10-like
           protein.
          Length = 36

 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 29/33 (87%), Positives = 29/33 (87%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDL 99
           RPARCYRY KNKPYPKSR  RGVPD KIRIFDL
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDL 36


>AB007170-1|BAA28595.1|   80|Homo sapiens ribosomal protein L10
           protein.
          Length = 80

 Score = 33.1 bits (72), Expect = 0.83
 Identities = 15/25 (60%), Positives = 17/25 (68%)
 Frame = +3

Query: 462 FKFPGRAKDLRIKEVGFTKYERDEF 536
           FKFPGR K    K+ GFTK+  DEF
Sbjct: 23  FKFPGRQKIHISKKWGFTKFNADEF 47


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 84,105,971
Number of Sequences: 237096
Number of extensions: 1627840
Number of successful extensions: 3071
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 2914
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3034
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6804036910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -