SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ640137-1|CAG26691.1| 2697|Homo sapiens delangin protein.             34   0.39 
AJ627032-1|CAF25290.1| 2804|Homo sapiens delangin protein.             34   0.39 
AB019602-1|BAA77349.1| 2158|Homo sapiens IDN3-B protein.               34   0.39 
AB019494-1|BAA77335.1| 2265|Homo sapiens IDN3 protein.                 34   0.39 
X80289-1|CAA56563.1| 2466|Homo sapiens protein-tyrosine-phosphat...    31   3.6  
X79676-1|CAA56124.1| 1267|Homo sapiens tyrosine phosphatase prot...    31   3.6  
U12128-1|AAB60339.1| 2490|Homo sapiens protein tyrosine phosphat...    31   3.6  
D21211-1|BAA04752.1| 2294|Homo sapiens protein tyrosine phosphat...    31   3.6  
D21210-1|BAA04751.1| 2466|Homo sapiens protein tyrosine phosphat...    31   3.6  
D21209-1|BAA04750.1| 2485|Homo sapiens protein tyrosine phosphat...    31   3.6  
AC105413-1|AAY40972.1| 1305|Homo sapiens unknown protein.              31   3.6  
AB208904-1|BAD92141.1| 2434|Homo sapiens protein tyrosine phosph...    31   3.6  
U43416-1|AAA86260.1|  861|Homo sapiens replication control prote...    31   4.8  
U40152-1|AAC50325.1|  861|Homo sapiens HsORC1 protein.                 31   4.8  
BC011539-1|AAH11539.1|  861|Homo sapiens origin recognition comp...    31   4.8  
AL513218-8|CAI12288.1|  861|Homo sapiens origin recognition comp...    31   4.8  
BC111728-1|AAI11729.1|  889|Homo sapiens oxysterol-binding prote...    30   6.3  
BC101529-1|AAI01530.1|  889|Homo sapiens oxysterol binding prote...    30   6.3  
BC093834-1|AAH93834.1|  889|Homo sapiens oxysterol binding prote...    30   6.3  
BC012935-1|AAH12935.1|  377|Homo sapiens OSBPL8 protein protein.       30   6.3  
AK172813-1|BAD18783.1|  133|Homo sapiens protein ( Homo sapiens ...    30   6.3  
AF392452-1|AAL40665.1|  889|Homo sapiens oxysterol-binding prote...    30   6.3  
AB040884-1|BAA95975.3|  939|Homo sapiens KIAA1451 protein protein.     30   6.3  
BX649186-1|CAE46204.1|  669|Homo sapiens hypothetical protein pr...    30   8.3  
BC033630-1|AAH33630.1|  344|Homo sapiens sorting nexin 16 protein.     30   8.3  
AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related form...    30   8.3  
AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 pr...    30   8.3  
AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (D...    30   8.3  
AK092024-1|BAC03793.1|  699|Homo sapiens protein ( Homo sapiens ...    30   8.3  
AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous ho...    30   8.3  
AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous ho...    30   8.3  
AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous ho...    30   8.3  

>AJ640137-1|CAG26691.1| 2697|Homo sapiens delangin protein.
          Length = 2697

 Score = 34.3 bits (75), Expect = 0.39
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +1

Query: 424  LENKKRERQITPSPELKKASSDEEEVISLPTK-RKRIRLNPVDSDDSD 564
            +++K++ER+ +PS E    SSD EE +S P K RKR+  +  DSD  D
Sbjct: 2473 VKDKRKERKSSPSKE--NESSDSEEEVSRPRKSRKRVD-SDSDSDSED 2517


>AJ627032-1|CAF25290.1| 2804|Homo sapiens delangin protein.
          Length = 2804

 Score = 34.3 bits (75), Expect = 0.39
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +1

Query: 424  LENKKRERQITPSPELKKASSDEEEVISLPTK-RKRIRLNPVDSDDSD 564
            +++K++ER+ +PS E    SSD EE +S P K RKR+  +  DSD  D
Sbjct: 2473 VKDKRKERKSSPSKE--NESSDSEEEVSRPRKSRKRVD-SDSDSDSED 2517


>AB019602-1|BAA77349.1| 2158|Homo sapiens IDN3-B protein.
          Length = 2158

 Score = 34.3 bits (75), Expect = 0.39
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +1

Query: 424  LENKKRERQITPSPELKKASSDEEEVISLPTK-RKRIRLNPVDSDDSD 564
            +++K++ER+ +PS E    SSD EE +S P K RKR+  +  DSD  D
Sbjct: 1934 VKDKRKERKSSPSKE--NESSDSEEEVSRPRKSRKRVD-SDSDSDSED 1978


>AB019494-1|BAA77335.1| 2265|Homo sapiens IDN3 protein.
          Length = 2265

 Score = 34.3 bits (75), Expect = 0.39
 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +1

Query: 424  LENKKRERQITPSPELKKASSDEEEVISLPTK-RKRIRLNPVDSDDSD 564
            +++K++ER+ +PS E    SSD EE +S P K RKR+  +  DSD  D
Sbjct: 1934 VKDKRKERKSSPSKE--NESSDSEEEVSRPRKSRKRVD-SDSDSDSED 1978


>X80289-1|CAA56563.1| 2466|Homo sapiens protein-tyrosine-phosphatase
            protein.
          Length = 2466

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +3

Query: 345  NKKLKADATEDTDCNGSP 398
            N KL  + TEDTDC+GSP
Sbjct: 2072 NGKLSEERTEDTDCDGSP 2089


>X79676-1|CAA56124.1| 1267|Homo sapiens tyrosine phosphatase
           protein.
          Length = 1267

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +3

Query: 345 NKKLKADATEDTDCNGSP 398
           N KL  + TEDTDC+GSP
Sbjct: 874 NGKLSEERTEDTDCDGSP 891


>U12128-1|AAB60339.1| 2490|Homo sapiens protein tyrosine phosphatase
            1E protein.
          Length = 2490

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +3

Query: 345  NKKLKADATEDTDCNGSP 398
            N KL  + TEDTDC+GSP
Sbjct: 2096 NGKLSEERTEDTDCDGSP 2113


>D21211-1|BAA04752.1| 2294|Homo sapiens protein tyrosine phosphatase
            type 3 protein.
          Length = 2294

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +3

Query: 345  NKKLKADATEDTDCNGSP 398
            N KL  + TEDTDC+GSP
Sbjct: 1900 NGKLSEERTEDTDCDGSP 1917


>D21210-1|BAA04751.1| 2466|Homo sapiens protein tyrosine phosphatase
            type 2 protein.
          Length = 2466

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +3

Query: 345  NKKLKADATEDTDCNGSP 398
            N KL  + TEDTDC+GSP
Sbjct: 2072 NGKLSEERTEDTDCDGSP 2089


>D21209-1|BAA04750.1| 2485|Homo sapiens protein tyrosine phosphatase
            type 1 protein.
          Length = 2485

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +3

Query: 345  NKKLKADATEDTDCNGSP 398
            N KL  + TEDTDC+GSP
Sbjct: 2091 NGKLSEERTEDTDCDGSP 2108


>AC105413-1|AAY40972.1| 1305|Homo sapiens unknown protein.
          Length = 1305

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +3

Query: 345 NKKLKADATEDTDCNGSP 398
           N KL  + TEDTDC+GSP
Sbjct: 911 NGKLSEERTEDTDCDGSP 928


>AB208904-1|BAD92141.1| 2434|Homo sapiens protein tyrosine
            phosphatase, non-receptor type 13 isoform 2 variant
            protein.
          Length = 2434

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +3

Query: 345  NKKLKADATEDTDCNGSP 398
            N KL  + TEDTDC+GSP
Sbjct: 2040 NGKLSEERTEDTDCDGSP 2057


>U43416-1|AAA86260.1|  861|Homo sapiens replication control protein
           1 protein.
          Length = 861

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIR 534
           ++ + E++I P+ E+  +SSDEEE  + P  R+  R
Sbjct: 402 KSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPR 437


>U40152-1|AAC50325.1|  861|Homo sapiens HsORC1 protein.
          Length = 861

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIR 534
           ++ + E++I P+ E+  +SSDEEE  + P  R+  R
Sbjct: 402 KSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPR 437


>BC011539-1|AAH11539.1|  861|Homo sapiens origin recognition
           complex, subunit 1-like (yeast) protein.
          Length = 861

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIR 534
           ++ + E++I P+ E+  +SSDEEE  + P  R+  R
Sbjct: 402 KSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPR 437


>AL513218-8|CAI12288.1|  861|Homo sapiens origin recognition
           complex, subunit 1-like (yeast) protein.
          Length = 861

 Score = 30.7 bits (66), Expect = 4.8
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIR 534
           ++ + E++I P+ E+  +SSDEEE  + P  R+  R
Sbjct: 402 KSDQEEKEILPAAEISDSSSDEEEASTPPLPRRAPR 437


>BC111728-1|AAI11729.1|  889|Homo sapiens oxysterol-binding
           protein-like protein 8, isoform a protein.
          Length = 889

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 373 KIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR-IRLNPVD 549
           + P+V VP K   K    + K  +   +P P+++ +S  E + +   T+RK+ I L  + 
Sbjct: 773 RTPMVSVP-KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQ 831

Query: 550 SDDSDVE 570
           S    ++
Sbjct: 832 SSIESIK 838


>BC101529-1|AAI01530.1|  889|Homo sapiens oxysterol binding
           protein-like 8 protein.
          Length = 889

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 373 KIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR-IRLNPVD 549
           + P+V VP K   K    + K  +   +P P+++ +S  E + +   T+RK+ I L  + 
Sbjct: 773 RTPMVSVP-KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQ 831

Query: 550 SDDSDVE 570
           S    ++
Sbjct: 832 SSIESIK 838


>BC093834-1|AAH93834.1|  889|Homo sapiens oxysterol binding
           protein-like 8 protein.
          Length = 889

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 373 KIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR-IRLNPVD 549
           + P+V VP K   K    + K  +   +P P+++ +S  E + +   T+RK+ I L  + 
Sbjct: 773 RTPMVSVP-KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQ 831

Query: 550 SDDSDVE 570
           S    ++
Sbjct: 832 SSIESIK 838


>BC012935-1|AAH12935.1|  377|Homo sapiens OSBPL8 protein protein.
          Length = 377

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 373 KIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR-IRLNPVD 549
           + P+V VP K   K    + K  +   +P P+++ +S  E + +   T+RK+ I L  + 
Sbjct: 261 RTPMVSVP-KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQ 319

Query: 550 SDDSDVE 570
           S    ++
Sbjct: 320 SSIESIK 326


>AK172813-1|BAD18783.1|  133|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23974 fis, clone HEP18860. ).
          Length = 133

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 373 KIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR-IRLNPVD 549
           + P+V VP K   K    + K  +   +P P+++ +S  E + +   T+RK+ I L  + 
Sbjct: 17  RTPMVSVP-KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQ 75

Query: 550 SDDSDVE 570
           S    ++
Sbjct: 76  SSIESIK 82


>AF392452-1|AAL40665.1|  889|Homo sapiens oxysterol-binding
           protein-like protein OSBPL8 protein.
          Length = 889

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 373 KIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR-IRLNPVD 549
           + P+V VP K   K    + K  +   +P P+++ +S  E + +   T+RK+ I L  + 
Sbjct: 773 RTPMVSVP-KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQ 831

Query: 550 SDDSDVE 570
           S    ++
Sbjct: 832 SSIESIK 838


>AB040884-1|BAA95975.3|  939|Homo sapiens KIAA1451 protein protein.
          Length = 939

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 373  KIPIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKR-IRLNPVD 549
            + P+V VP K   K    + K  +   +P P+++ +S  E + +   T+RK+ I L  + 
Sbjct: 823  RTPMVSVP-KMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQ 881

Query: 550  SDDSDVE 570
            S    ++
Sbjct: 882  SSIESIK 888


>BX649186-1|CAE46204.1|  669|Homo sapiens hypothetical protein
           protein.
          Length = 669

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>BC033630-1|AAH33630.1|  344|Homo sapiens sorting nexin 16 protein.
          Length = 344

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 3/64 (4%)
 Frame = +1

Query: 406 SKKGIH---LENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENK 576
           S+K +H   LEN+ R   + P   L  + ++ E+++ + +         VD D  D E++
Sbjct: 259 SEKQLHIDTLENRIRTLSLEPEESLDVSETEGEQILKVESSALE-----VDQDVLDEESR 313

Query: 577 ADNK 588
           ADNK
Sbjct: 314 ADNK 317


>AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related formin
           3 protein.
          Length = 1112

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3
           protein.
          Length = 1152

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1193

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1123

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 99  KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 138


>AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1182

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 158 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 197


>AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1147

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 123 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 162


>AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1112

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1193

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1123

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 99  KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 138


>AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1182

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 158 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 197


>AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1147

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 123 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 162


>AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1193

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1123

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 99  KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 138


>AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1182

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 158 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 197


>AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1147

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 123 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 162


>AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1112

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1193

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1123

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 99  KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 138


>AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1182

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 158 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 197


>AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1147

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 123 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 162


>AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3
           (Drosophila) protein.
          Length = 1112

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AK092024-1|BAC03793.1|  699|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34705 fis, clone MESAN2003035, highly similar to
           Mus musculus diaphanous-related formin (Dia2) mRNA. ).
          Length = 699

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 169 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 208


>AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous
           homologue 2_splice_variant2 protein.
          Length = 1123

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 99  KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 138


>AB244757-1|BAE96351.1| 1147|Homo sapiens mammalian diaphanous
           homologue 2_splice_variant1 protein.
          Length = 1147

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 123 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 162


>AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous
           homologue 2 protein.
          Length = 1182

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +1

Query: 436 KRERQITPSP---ELKKASSDEEEVISLPTKRKRIRLNPV 546
           KR RQI+P     ELK  S+DE  V  L + R  +  NPV
Sbjct: 158 KRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPV 197


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 74,839,597
Number of Sequences: 237096
Number of extensions: 1389944
Number of successful extensions: 3776
Number of sequences better than 10.0: 50
Number of HSP's better than 10.0 without gapping: 3455
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3748
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7366354010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -