SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X54941-1|CAA38702.1|   79|Homo sapiens Cks1 protein homologue pr...   123   5e-28
BT007196-1|AAP35860.1|   79|Homo sapiens CDC28 protein kinase re...   123   5e-28
BC070320-1|AAH70320.1|   79|Homo sapiens CDC28 protein kinase re...   123   5e-28
BC070319-1|AAH70319.1|   79|Homo sapiens CDC28 protein kinase re...   123   5e-28
BC015629-1|AAH15629.1|   79|Homo sapiens CDC28 protein kinase re...   123   5e-28
BC007751-1|AAH07751.1|   79|Homo sapiens CDC28 protein kinase re...   123   5e-28
AL451085-19|CAI13256.1|   79|Homo sapiens CDC28 protein kinase r...   123   5e-28
AF279897-1|AAK07553.1|   79|Homo sapiens PNAS-143 protein.            123   5e-28
AF274941-1|AAK07518.1|   79|Homo sapiens PNAS-16 protein.             123   5e-28
X54942-1|CAA38703.1|   79|Homo sapiens Cks1 protein homologue pr...   115   1e-25
CR542118-1|CAG46915.1|   79|Homo sapiens CKS2 protein.                115   1e-25
BT006630-1|AAP35276.1|   79|Homo sapiens CDC28 protein kinase re...   115   1e-25
BC006458-1|AAH06458.1|   79|Homo sapiens CDC28 protein kinase re...   115   1e-25
AL160054-3|CAI41365.1|   79|Homo sapiens CDC28 protein kinase re...   115   1e-25
AF506708-1|AAM22232.1|   79|Homo sapiens CDC28 protein kinase 2 ...   115   1e-25
CR407630-1|CAG28558.1|   79|Homo sapiens CKS2 protein.                112   9e-25
AL451085-20|CAI13257.1|   63|Homo sapiens CDC28 protein kinase r...   103   5e-22
AF274943-1|AAK07520.1|   63|Homo sapiens PNAS-18 protein.             103   5e-22
AL451085-18|CAI13255.1|   67|Homo sapiens CDC28 protein kinase r...   101   2e-21

>X54941-1|CAA38702.1|   79|Homo sapiens Cks1 protein homologue
           protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>BT007196-1|AAP35860.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 1B protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>BC070320-1|AAH70320.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 1B protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>BC070319-1|AAH70319.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 1B protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>BC015629-1|AAH15629.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 1B protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>BC007751-1|AAH07751.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 1B protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>AL451085-19|CAI13256.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 1B protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>AF279897-1|AAK07553.1|   79|Homo sapiens PNAS-143 protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>AF274941-1|AAK07518.1|   79|Homo sapiens PNAS-16 protein.
          Length = 79

 Score =  123 bits (297), Expect = 5e-28
 Identities = 48/68 (70%), Positives = 62/68 (91%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>X54942-1|CAA38703.1|   79|Homo sapiens Cks1 protein homologue
           protein.
          Length = 79

 Score =  115 bits (277), Expect = 1e-25
 Identities = 45/68 (66%), Positives = 59/68 (86%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ YEYRHV+LP ++++ VPK+HLM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>CR542118-1|CAG46915.1|   79|Homo sapiens CKS2 protein.
          Length = 79

 Score =  115 bits (277), Expect = 1e-25
 Identities = 45/68 (66%), Positives = 59/68 (86%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ YEYRHV+LP ++++ VPK+HLM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>BT006630-1|AAP35276.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 2 protein.
          Length = 79

 Score =  115 bits (277), Expect = 1e-25
 Identities = 45/68 (66%), Positives = 59/68 (86%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ YEYRHV+LP ++++ VPK+HLM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>BC006458-1|AAH06458.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 2 protein.
          Length = 79

 Score =  115 bits (277), Expect = 1e-25
 Identities = 45/68 (66%), Positives = 59/68 (86%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ YEYRHV+LP ++++ VPK+HLM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>AL160054-3|CAI41365.1|   79|Homo sapiens CDC28 protein kinase
           regulatory subunit 2 protein.
          Length = 79

 Score =  115 bits (277), Expect = 1e-25
 Identities = 45/68 (66%), Positives = 59/68 (86%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ YEYRHV+LP ++++ VPK+HLM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>AF506708-1|AAM22232.1|   79|Homo sapiens CDC28 protein kinase 2
           protein.
          Length = 79

 Score =  115 bits (277), Expect = 1e-25
 Identities = 45/68 (66%), Positives = 59/68 (86%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ YEYRHV+LP ++++ VPK+HLM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>CR407630-1|CAG28558.1|   79|Homo sapiens CKS2 protein.
          Length = 79

 Score =  112 bits (270), Expect = 9e-25
 Identities = 44/68 (64%), Positives = 58/68 (85%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEP 301
           QI YS++Y D+ YEY HV+LP ++++ VPK+HLM+E EWR LGVQQS GW+H+M+H PEP
Sbjct: 5   QIYYSDKYFDEHYEYLHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEP 64

Query: 302 HVLLFRRP 325
           H+LLFRRP
Sbjct: 65  HILLFRRP 72


>AL451085-20|CAI13257.1|   63|Homo sapiens CDC28 protein kinase
           regulatory subunit 1B protein.
          Length = 63

 Score =  103 bits (247), Expect = 5e-22
 Identities = 40/53 (75%), Positives = 50/53 (94%)
 Frame = +2

Query: 167 RHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRP 325
           RHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEPH+LLFRRP
Sbjct: 4   RHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRP 56


>AF274943-1|AAK07520.1|   63|Homo sapiens PNAS-18 protein.
          Length = 63

 Score =  103 bits (247), Expect = 5e-22
 Identities = 40/53 (75%), Positives = 50/53 (94%)
 Frame = +2

Query: 167 RHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPHVLLFRRP 325
           RHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H PEPH+LLFRRP
Sbjct: 4   RHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRP 56


>AL451085-18|CAI13255.1|   67|Homo sapiens CDC28 protein kinase
           regulatory subunit 1B protein.
          Length = 67

 Score =  101 bits (243), Expect = 2e-21
 Identities = 39/58 (67%), Positives = 52/58 (89%)
 Frame = +2

Query: 122 QIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNP 295
           QI YS++Y D+ +EYRHV+LP DIA++VPK+HLM+E+EWRNLGVQQS GW+H+M+H P
Sbjct: 5   QIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEP 62


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,923,023
Number of Sequences: 237096
Number of extensions: 1745165
Number of successful extensions: 7305
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 7237
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7305
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6860268620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -