SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC131532-1|AAI31533.1|  189|Homo sapiens FLJ40113 protein protein.     32   1.6  
AK097432-1|BAC05050.1|  466|Homo sapiens protein ( Homo sapiens ...    32   1.6  
AK092490-1|BAC03904.1|  280|Homo sapiens protein ( Homo sapiens ...    32   1.6  
BC041854-1|AAH41854.1|  274|Homo sapiens hypothetical protein LO...    31   2.7  
BC125178-1|AAI25179.1|  577|Homo sapiens acyl-CoA synthetase med...    30   8.3  
AB062503-1|BAB68363.1|  577|Homo sapiens middle-chain acyl-CoA s...    30   8.3  
AB059429-1|BAB64535.1|  577|Homo sapiens medium-chain acyl-CoA s...    30   8.3  

>BC131532-1|AAI31533.1|  189|Homo sapiens FLJ40113 protein protein.
          Length = 189

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +3

Query: 99  REKSSCENRHST-EQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDL 275
           +E+  CE      EQ+ R     +LP  E L   +++ L  + R       + ++  ++ 
Sbjct: 60  QEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLEE 119

Query: 276 VERLLEQRALVAEAVRRLKEKK 341
           VE+LLEQ     E  R L+ ++
Sbjct: 120 VEKLLEQERRQEEQERLLERER 141



 Score = 31.9 bits (69), Expect = 2.1
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = +3

Query: 135 EQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQRALVAE 314
           EQ+RRQ    RL   E L   +++ L  + R       + ++  ++ VE+LLEQ     E
Sbjct: 99  EQERRQEEQERLLERERLLEEVEKLLEQERRQEEQERLLERERLLEEVEKLLEQERRQEE 158

Query: 315 AVRRLKEKK 341
             R L+ ++
Sbjct: 159 QERLLERER 167


>AK097432-1|BAC05050.1|  466|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40113 fis, clone TESTI2008621. ).
          Length = 466

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +3

Query: 99  REKSSCENRHST-EQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDL 275
           +E+  CE      EQ+ R     +LP  E L   +++ L  + R       + ++  ++ 
Sbjct: 337 QEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLEE 396

Query: 276 VERLLEQRALVAEAVRRLKEKK 341
           VE+LLEQ     E  R L+ ++
Sbjct: 397 VEKLLEQERRQEEQERLLERER 418



 Score = 31.9 bits (69), Expect = 2.1
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = +3

Query: 135 EQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQRALVAE 314
           EQ+RRQ    RL   E L   +++ L  + R       + ++  ++ VE+LLEQ     E
Sbjct: 376 EQERRQEEQERLLERERLLEEVEKLLEQERRQEEQERLLERERLLEEVEKLLEQERRQEE 435

Query: 315 AVRRLKEKK 341
             R L+ ++
Sbjct: 436 QERLLERER 444


>AK092490-1|BAC03904.1|  280|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35171 fis, clone PLACE6013220, weakly similar to
           TRICHOHYALIN. ).
          Length = 280

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 21/82 (25%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +3

Query: 99  REKSSCENRHST-EQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDL 275
           +E+  CE      EQ+ R     +LP  E L   +++ L  + R       + ++  ++ 
Sbjct: 142 QEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLEE 201

Query: 276 VERLLEQRALVAEAVRRLKEKK 341
           VE+LLEQ     E  R L+ ++
Sbjct: 202 VEKLLEQERQQEEQERLLERER 223



 Score = 30.3 bits (65), Expect = 6.3
 Identities = 19/69 (27%), Positives = 34/69 (49%)
 Frame = +3

Query: 135 EQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQRALVAE 314
           EQ+RRQ    RL   E L   +++ L  + +       + ++  ++ VE+LLEQ     E
Sbjct: 181 EQERRQEEQERLLERERLLEEVEKLLEQERQQEEQERLLERERLLEEVEKLLEQERRQEE 240

Query: 315 AVRRLKEKK 341
             R L+ ++
Sbjct: 241 QERLLERER 249


>BC041854-1|AAH41854.1|  274|Homo sapiens hypothetical protein
           LOC440295 protein.
          Length = 274

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = +3

Query: 99  REKSSCENRHST-EQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDL 275
           +E+  CE      EQ+ R     +LP  E L   +++ L  + R       + ++  +D 
Sbjct: 60  QEERLCEQEERLREQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLLDE 119

Query: 276 VERLLEQRAL 305
           VE LLEQ  L
Sbjct: 120 VEELLEQERL 129


>BC125178-1|AAI25179.1|  577|Homo sapiens acyl-CoA synthetase
           medium-chain family member 1 protein.
          Length = 577

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +2

Query: 464 ICGERARKGWLSVTCLARHESRERTKMAARTLQSTIIIF 580
           +  + +R+GWL    L +  S E T + ++TL   +I F
Sbjct: 187 LVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFF 225


>AB062503-1|BAB68363.1|  577|Homo sapiens middle-chain acyl-CoA
           synthetase1 protein.
          Length = 577

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +2

Query: 464 ICGERARKGWLSVTCLARHESRERTKMAARTLQSTIIIF 580
           +  + +R+GWL    L +  S E T + ++TL   +I F
Sbjct: 187 LVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFF 225


>AB059429-1|BAB64535.1|  577|Homo sapiens medium-chain acyl-CoA
           synthetase protein.
          Length = 577

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +2

Query: 464 ICGERARKGWLSVTCLARHESRERTKMAARTLQSTIIIF 580
           +  + +R+GWL    L +  S E T + ++TL   +I F
Sbjct: 187 LVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFF 225


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 88,991,979
Number of Sequences: 237096
Number of extensions: 1722747
Number of successful extensions: 4129
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 3917
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4128
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7366354010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -