SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L06498-1|AAA60286.1|  119|Homo sapiens ribosomal protein S20 pro...   101   1e-21
BC087850-1|AAH87850.1|  119|Homo sapiens ribosomal protein S20 p...   101   1e-21
BC007507-1|AAH07507.1|  119|Homo sapiens ribosomal protein S20 p...   101   1e-21
AB061842-1|BAB79480.1|  119|Homo sapiens ribosomal protein S20 p...   101   1e-21
AB007156-1|BAA25820.1|   60|Homo sapiens ribosomal protein S20 p...    85   1e-16
D25538-1|BAA05021.2| 1088|Homo sapiens KIAA0037 protein.               30   5.4  
BC126271-1|AAI26272.1| 1080|Homo sapiens adenylate cyclase 7 pro...    30   5.4  
BC101386-1|AAI01387.1|  576|Homo sapiens PLEKHN1 protein protein.      29   7.1  
AL645608-8|CAI15570.1|  611|Homo sapiens pleckstrin homology dom...    29   7.1  

>L06498-1|AAA60286.1|  119|Homo sapiens ribosomal protein S20
           protein.
          Length = 119

 Score =  101 bits (242), Expect = 1e-21
 Identities = 47/49 (95%), Positives = 49/49 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIADA
Sbjct: 71  GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119



 Score = 99.1 bits (236), Expect = 8e-21
 Identities = 50/66 (75%), Positives = 54/66 (81%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KD  K   E    IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI
Sbjct: 4   KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 64  TTRKTP 69


>BC087850-1|AAH87850.1|  119|Homo sapiens ribosomal protein S20
           protein.
          Length = 119

 Score =  101 bits (242), Expect = 1e-21
 Identities = 47/49 (95%), Positives = 49/49 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIADA
Sbjct: 71  GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119



 Score = 99.1 bits (236), Expect = 8e-21
 Identities = 50/66 (75%), Positives = 54/66 (81%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KD  K   E    IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI
Sbjct: 4   KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 64  TTRKTP 69


>BC007507-1|AAH07507.1|  119|Homo sapiens ribosomal protein S20
           protein.
          Length = 119

 Score =  101 bits (242), Expect = 1e-21
 Identities = 47/49 (95%), Positives = 49/49 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIADA
Sbjct: 71  GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119



 Score = 99.1 bits (236), Expect = 8e-21
 Identities = 50/66 (75%), Positives = 54/66 (81%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KD  K   E    IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI
Sbjct: 4   KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 64  TTRKTP 69


>AB061842-1|BAB79480.1|  119|Homo sapiens ribosomal protein S20
           protein.
          Length = 119

 Score =  101 bits (242), Expect = 1e-21
 Identities = 47/49 (95%), Positives = 49/49 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 478
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIADA
Sbjct: 71  GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 119



 Score = 99.1 bits (236), Expect = 8e-21
 Identities = 50/66 (75%), Positives = 54/66 (81%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQAEVS-PIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KD  K   E    IHRIRITLTSRNV+SLEKVCADLI GAK++ L+VKGPVRMPTK LRI
Sbjct: 4   KDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRI 63

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 64  TTRKTP 69


>AB007156-1|BAA25820.1|   60|Homo sapiens ribosomal protein S20
           protein.
          Length = 60

 Score = 85.0 bits (201), Expect = 1e-16
 Identities = 38/40 (95%), Positives = 40/40 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGV 451
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVKQITSI+IEPGV
Sbjct: 21  GEGSKTWDRFQMRIHKRLIDLHSPSEIVKQITSISIEPGV 60



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 18/19 (94%), Positives = 18/19 (94%)
 Frame = +1

Query: 271 KGPVRMPTKILRITTRKTP 327
           KGPVRMPTK LRITTRKTP
Sbjct: 1   KGPVRMPTKTLRITTRKTP 19


>D25538-1|BAA05021.2| 1088|Homo sapiens KIAA0037 protein.
          Length = 1088

 Score = 29.9 bits (64), Expect = 5.4
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = +3

Query: 72  KSCLSRPEFNKQHGSRC-SVRQRHRETPGRGL-PYSPHQDHSYFSQCALTREGL 227
           +  +S  E +  +G R  SV QRHR TP R + P    +D SY  +     EGL
Sbjct: 511 RESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSYDDEMLSAIEGL 564


>BC126271-1|AAI26272.1| 1080|Homo sapiens adenylate cyclase 7
           protein.
          Length = 1080

 Score = 29.9 bits (64), Expect = 5.4
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = +3

Query: 72  KSCLSRPEFNKQHGSRC-SVRQRHRETPGRGL-PYSPHQDHSYFSQCALTREGL 227
           +  +S  E +  +G R  SV QRHR TP R + P    +D SY  +     EGL
Sbjct: 503 RESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSYDDEMLSAIEGL 556


>BC101386-1|AAI01387.1|  576|Homo sapiens PLEKHN1 protein protein.
          Length = 576

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 27/87 (31%), Positives = 35/87 (40%), Gaps = 4/87 (4%)
 Frame = +3

Query: 66  DLKSCLSRPE----FNKQHGSRCSVRQRHRETPGRGLPYSPHQDHSYFSQCALTREGLC* 233
           D +SC S P      +K+   +    QRHR +   G P  P       S     REG   
Sbjct: 471 DPRSCSSGPAGPYLLSKKGALQSRAAQRHRGSAKDGGPQPPDAPQLVSS----AREGS-- 524

Query: 234 PNQWSQETEAACKGPSPHANQDPAYHH 314
           P  W   T+    G SP  ++DP Y H
Sbjct: 525 PEPWLPLTD----GRSPRRSRDPGYDH 547


>AL645608-8|CAI15570.1|  611|Homo sapiens pleckstrin homology domain
           containing, family N member 1 protein.
          Length = 611

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 27/87 (31%), Positives = 35/87 (40%), Gaps = 4/87 (4%)
 Frame = +3

Query: 66  DLKSCLSRPE----FNKQHGSRCSVRQRHRETPGRGLPYSPHQDHSYFSQCALTREGLC* 233
           D +SC S P      +K+   +    QRHR +   G P  P       S     REG   
Sbjct: 506 DPRSCSSGPAGPYLLSKKGALQSRAAQRHRGSAKDGGPQPPDAPQLVSS----AREGS-- 559

Query: 234 PNQWSQETEAACKGPSPHANQDPAYHH 314
           P  W   T+    G SP  ++DP Y H
Sbjct: 560 PEPWLPLTD----GRSPRRSRDPGYDH 582


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,766,553
Number of Sequences: 237096
Number of extensions: 1819490
Number of successful extensions: 4097
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3831
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4092
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4763295768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -