SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U14972-1|AAA85660.1|  165|Homo sapiens ribosomal protein S10 pro...   219   7e-57
BX255972-2|CAH73100.1|  165|Homo sapiens ribosomal protein S10 p...   219   7e-57
BC073799-1|AAH73799.1|  165|Homo sapiens RPS10 protein protein.       219   7e-57
BC071946-1|AAH71946.1|  165|Homo sapiens ribosomal protein S10 p...   219   7e-57
BC070235-1|AAH70235.1|  165|Homo sapiens RPS10 protein protein.       219   7e-57
BC005012-1|AAH05012.1|  165|Homo sapiens RPS10 protein protein.       219   7e-57
BC001955-1|AAH01955.1|  165|Homo sapiens RPS10 protein protein.       219   7e-57
BC001032-1|AAH01032.1|  165|Homo sapiens ribosomal protein S10 p...   219   7e-57
AB209165-1|BAD92402.1|  174|Homo sapiens ribosomal protein S10 v...   217   3e-56
BX255972-3|CAH73101.1|  172|Homo sapiens ribosomal protein S10 p...   203   3e-52
AB007151-1|BAA25817.1|   78|Homo sapiens ribosomal protein S10 p...   138   9e-33
AY480047-1|AAR95680.1| 4684|Homo sapiens plectin 6 protein.           128   1e-29
Z54367-1|CAA91196.1| 4684|Homo sapiens plectin protein.               123   5e-28
BC030568-1|AAH30568.1|   72|Homo sapiens LOC376693 protein protein.    94   3e-19
Z70761-1|CAA94807.1|   58|Homo sapiens ribosomal protein S10 pro...    45   2e-04
U66541-1|AAC51633.1| 1822|Homo sapiens beta4-integrin protein.         31   2.1  
BC105109-1|AAI05110.1|  269|Homo sapiens CCAAT/enhancer binding ...    31   2.1  
AJ251004-1|CAB61345.1| 1873|Homo sapiens integrin beta 4 protein.      31   2.1  
BC103835-1|AAI03836.1|  691|Homo sapiens PR domain containing 1,...    31   2.7  
S63168-1|AAB27293.1|  269|Homo sapiens CCAAT/enhancer-binding pr...    31   3.6  
M83667-1|AAA59927.1|  269|Homo sapiens NF-IL6-beta protein protein.    31   3.6  
EF064715-1|ABK41898.1|  789|Homo sapiens PR domain containing 1,...    31   3.6  
BC103834-1|AAI03835.1|  691|Homo sapiens PR domain containing 1,...    31   3.6  
BC103833-1|AAI03834.1|  691|Homo sapiens PR domain containing 1,...    31   3.6  
BC103832-1|AAI03833.1|  691|Homo sapiens PR domain containing 1,...    31   3.6  
AY198415-1|AAO45624.1|  691|Homo sapiens PR domain-containing pr...    31   3.6  
AY198414-1|AAO45623.1|  789|Homo sapiens PR domain-containing pr...    31   3.6  
AL358952-2|CAI18902.1|  789|Homo sapiens PR domain containing 1,...    31   3.6  
AL022067-3|CAI42296.1|  789|Homo sapiens PR domain containing 1,...    31   3.6  
AK126796-1|BAC86698.1|  195|Homo sapiens protein ( Homo sapiens ...    31   3.6  
AF084199-1|AAC33300.1|  789|Homo sapiens beta-interferon gene po...    31   3.6  
AB029022-1|BAA83051.2|  864|Homo sapiens KIAA1099 protein protein.     31   3.6  
L04288-1|AAA35734.2| 1462|Homo sapiens cyclophilin-related prote...    29   8.4  
BX641127-1|CAE46057.1|  191|Homo sapiens hypothetical protein pr...    29   8.4  
BX640751-1|CAE45859.1|  590|Homo sapiens hypothetical protein pr...    29   8.4  
AF184110-1|AAD56402.1| 1462|Homo sapiens cyclophilin-related pro...    29   8.4  
AB209888-1|BAD93125.1|  317|Homo sapiens natural killer-tumor re...    29   8.4  

>U14972-1|AAA85660.1|  165|Homo sapiens ribosomal protein S10
           protein.
          Length = 165

 Score =  219 bits (534), Expect = 7e-57
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>BX255972-2|CAH73100.1|  165|Homo sapiens ribosomal protein S10
           protein.
          Length = 165

 Score =  219 bits (534), Expect = 7e-57
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>BC073799-1|AAH73799.1|  165|Homo sapiens RPS10 protein protein.
          Length = 165

 Score =  219 bits (534), Expect = 7e-57
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>BC071946-1|AAH71946.1|  165|Homo sapiens ribosomal protein S10
           protein.
          Length = 165

 Score =  219 bits (534), Expect = 7e-57
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>BC070235-1|AAH70235.1|  165|Homo sapiens RPS10 protein protein.
          Length = 165

 Score =  219 bits (534), Expect = 7e-57
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>BC005012-1|AAH05012.1|  165|Homo sapiens RPS10 protein protein.
          Length = 165

 Score =  219 bits (534), Expect = 7e-57
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>BC001955-1|AAH01955.1|  165|Homo sapiens RPS10 protein protein.
          Length = 165

 Score =  219 bits (534), Expect = 7e-57
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>BC001032-1|AAH01032.1|  165|Homo sapiens ribosomal protein S10
           protein.
          Length = 165

 Score =  219 bits (534), Expect = 7e-57
 Identities = 111/164 (67%), Positives = 125/164 (76%), Gaps = 7/164 (4%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
              DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 160


>AB209165-1|BAD92402.1|  174|Homo sapiens ribosomal protein S10
           variant protein.
          Length = 174

 Score =  217 bits (529), Expect = 3e-56
 Identities = 110/165 (66%), Positives = 125/165 (75%), Gaps = 7/165 (4%)
 Frame = +2

Query: 53  KMLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVK 226
           +MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVK
Sbjct: 9   QMLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVK 68

Query: 227 EQFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPA 394
           EQFAWRHFYWYLTNEGI+YLR +LHLPPEIVPA L+RS R ET R  P G    RP    
Sbjct: 69  EQFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPAILRRS-RPETGRPRPKGLEGERPARLT 127

Query: 395 RSAEDRSAYRRTPAAPGVAPHDKKADVGPGSA-DLEFKGGYGRGR 526
           R   DR  YRR+   PG    DKKA+ G GSA + +F+GG+GRGR
Sbjct: 128 RGEADRDTYRRSAVPPGA---DKKAEAGAGSATEFQFRGGFGRGR 169


>BX255972-3|CAH73101.1|  172|Homo sapiens ribosomal protein S10
           protein.
          Length = 172

 Score =  203 bits (496), Expect = 3e-52
 Identities = 104/151 (68%), Positives = 114/151 (75%), Gaps = 6/151 (3%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+NR+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKE 60

Query: 230 QFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVG----RPDAPAR 397
           QFAWRHFYWYLTNEGI+YLR +LHLPPEIVPATL+RS R ET R  P G    RP    R
Sbjct: 61  QFAWRHFYWYLTNEGIQYLRDYLHLPPEIVPATLRRS-RPETGRPRPKGLEGERPARLTR 119

Query: 398 SAEDRSAYRRTPAAPGVAPHDKKADVGPGSA 490
              DR  YRR+   PG    DKKA+ G GSA
Sbjct: 120 GEADRDTYRRSAVPPGA---DKKAEAGAGSA 147


>AB007151-1|BAA25817.1|   78|Homo sapiens ribosomal protein S10
           protein.
          Length = 78

 Score =  138 bits (335), Expect = 9e-33
 Identities = 63/78 (80%), Positives = 69/78 (88%), Gaps = 2/78 (2%)
 Frame = +2

Query: 77  RVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKEQFAWRHF 250
           R+AIYE LFKEGVMVAKKD H PKH EL  + +PNL V+KAMQSLKSRGYVKEQFAWRHF
Sbjct: 1   RIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHF 60

Query: 251 YWYLTNEGIEYLRIFLHL 304
           YWYLTNEGI+YLR +LHL
Sbjct: 61  YWYLTNEGIQYLRDYLHL 78


>AY480047-1|AAR95680.1| 4684|Homo sapiens plectin 6 protein.
          Length = 4684

 Score =  128 bits (309), Expect = 1e-29
 Identities = 73/140 (52%), Positives = 92/140 (65%), Gaps = 16/140 (11%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPK-HTELEKIPNLQVIKAMQSLKSRGYVKEQ 232
           MLMP+    AIYE LF+EGVMVAKKD      H  +  + NLQV++AM SL++RG V+E 
Sbjct: 5   MLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGLVRET 64

Query: 233 FAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKR----------SVRTETVR--RGPVG 376
           FAW HFYWYLTNEGI +LR +LHLPPEIVPA+L+R          + RT  V+  +GP+G
Sbjct: 65  FAWCHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQGPLG 124

Query: 377 RPDAPARS---AEDRSAYRR 427
            P  P R     E++  YRR
Sbjct: 125 SP--PKRGPLPTEEQRVYRR 142


>Z54367-1|CAA91196.1| 4684|Homo sapiens plectin protein.
          Length = 4684

 Score =  123 bits (296), Expect = 5e-28
 Identities = 71/140 (50%), Positives = 91/140 (65%), Gaps = 16/140 (11%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPK-HTELEKIPNLQVIKAMQSLKSRGYVKEQ 232
           MLMP+    AIYE LF+EGVMVAKKD      H  +  + NLQV++AM SL++RG V+E 
Sbjct: 5   MLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGLVRET 64

Query: 233 FAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKR----------SVRTETVR--RGPVG 376
           FAW HF+WYLTNEGI +LR +LHLPPEIV A+L+R          + RT  V+  +GP+G
Sbjct: 65  FAWCHFFWYLTNEGIAHLRQYLHLPPEIVAASLQRVRRPVAMVMPARRTPHVQAVQGPLG 124

Query: 377 RPDAPARS---AEDRSAYRR 427
            P  P R     E++  YRR
Sbjct: 125 SP--PKRGPLPTEEQRLYRR 142


>BC030568-1|AAH30568.1|   72|Homo sapiens LOC376693 protein protein.
          Length = 72

 Score = 93.9 bits (223), Expect = 3e-19
 Identities = 46/60 (76%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTEL--EKIPNLQVIKAMQSLKSRGYVKE 229
           MLMPK+N +AIYE LFKEGVMVAKKD H PKH EL  +  PNL+V+KAMQSLKSRGYVKE
Sbjct: 1   MLMPKKNWIAIYELLFKEGVMVAKKDVHMPKHPELADKNAPNLRVMKAMQSLKSRGYVKE 60


>Z70761-1|CAA94807.1|   58|Homo sapiens ribosomal protein S10
           protein.
          Length = 58

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +2

Query: 377 RPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPG-SADLEFKGGYGRGR 526
           RP    R   DR  YRR+   PG    DKKA+ G G   + +F+GG+GRGR
Sbjct: 7   RPARLTRGEADRDTYRRSAVPPGA---DKKAEAGLGQQPEFQFRGGFGRGR 54


>U66541-1|AAC51633.1| 1822|Homo sapiens beta4-integrin protein.
          Length = 1822

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 2/80 (2%)
 Frame = +2

Query: 260  LTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYR-RTPA 436
            L  E ++  R+   LPPE++P     S R+      P G PD      +  S  R  TP 
Sbjct: 1378 LLGEELDLRRVTWRLPPELIPRLSASSGRSSDA-EAPHGPPDDGGAGGKGGSLPRSATPG 1436

Query: 437  APGVAPHDKKADVG-PGSAD 493
             PG    + + D   PGS +
Sbjct: 1437 PPGEHLVNGRMDFAFPGSTN 1456


>BC105109-1|AAI05110.1|  269|Homo sapiens CCAAT/enhancer binding
           protein (C/EBP), delta protein.
          Length = 269

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 20/67 (29%), Positives = 29/67 (43%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPG 484
           P  ++PA +    +T  V     G+P  P      RS+ R+TP APG A        GP 
Sbjct: 131 PGSLLPAQVAACAQT-VVSLAAAGQPTPPTSPEPPRSSPRQTP-APGPAREKSAGKRGPD 188

Query: 485 SADLEFK 505
               E++
Sbjct: 189 RGSPEYR 195


>AJ251004-1|CAB61345.1| 1873|Homo sapiens integrin beta 4 protein.
          Length = 1873

 Score = 31.5 bits (68), Expect = 2.1
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 2/80 (2%)
 Frame = +2

Query: 260  LTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYR-RTPA 436
            L  E ++  R+   LPPE++P     S R+      P G PD      +  S  R  TP 
Sbjct: 1377 LLGEELDLRRVTWRLPPELIPRLSASSGRSSDA-EAPHGPPDDGGAGGKGGSLPRSATPG 1435

Query: 437  APGVAPHDKKADVG-PGSAD 493
             PG    + + D   PGS +
Sbjct: 1436 PPGEHLVNGRMDFAFPGSTN 1455


>BC103835-1|AAI03836.1|  691|Homo sapiens PR domain containing 1,
           with ZNF domain protein.
          Length = 691

 Score = 31.1 bits (67), Expect = 2.7
 Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 1/72 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 171 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 230

Query: 479 PGSADLEFKGGY 514
           PGS +      Y
Sbjct: 231 PGSQEHRDSNAY 242


>S63168-1|AAB27293.1|  269|Homo sapiens CCAAT/enhancer-binding
           protein delta protein.
          Length = 269

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 20/67 (29%), Positives = 29/67 (43%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPG 484
           P  ++PA +    +T  V     G+P  P      RS+ R+TP APG A        GP 
Sbjct: 131 PGSLLPAQVGPCAQT-VVSLAAAGQPTPPTSPEPPRSSPRQTP-APGPAREKSAGKRGPD 188

Query: 485 SADLEFK 505
               E++
Sbjct: 189 RGSPEYR 195


>M83667-1|AAA59927.1|  269|Homo sapiens NF-IL6-beta protein protein.
          Length = 269

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 20/67 (29%), Positives = 29/67 (43%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPG 484
           P  ++PA +    +T  V     G+P  P      RS+ R+TP APG A        GP 
Sbjct: 131 PGSLLPAQVGPCAQT-VVSLAAAGQPTPPTSPEPPRSSPRQTP-APGPAREKSAGKRGPD 188

Query: 485 SADLEFK 505
               E++
Sbjct: 189 RGSPEYR 195


>EF064715-1|ABK41898.1|  789|Homo sapiens PR domain containing 1,
           with ZNF domain protein.
          Length = 789

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 269 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 328

Query: 479 PGSAD 493
           PGS +
Sbjct: 329 PGSQE 333


>BC103834-1|AAI03835.1|  691|Homo sapiens PR domain containing 1,
           with ZNF domain protein.
          Length = 691

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 171 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 230

Query: 479 PGSAD 493
           PGS +
Sbjct: 231 PGSQE 235


>BC103833-1|AAI03834.1|  691|Homo sapiens PR domain containing 1,
           with ZNF domain protein.
          Length = 691

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 171 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 230

Query: 479 PGSAD 493
           PGS +
Sbjct: 231 PGSQE 235


>BC103832-1|AAI03833.1|  691|Homo sapiens PR domain containing 1,
           with ZNF domain protein.
          Length = 691

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 171 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 230

Query: 479 PGSAD 493
           PGS +
Sbjct: 231 PGSQE 235


>AY198415-1|AAO45624.1|  691|Homo sapiens PR domain-containing
           protein 1 beta protein.
          Length = 691

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 171 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 230

Query: 479 PGSAD 493
           PGS +
Sbjct: 231 PGSQE 235


>AY198414-1|AAO45623.1|  789|Homo sapiens PR domain-containing
           protein 1 alpha protein.
          Length = 789

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 269 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 328

Query: 479 PGSAD 493
           PGS +
Sbjct: 329 PGSQE 333


>AL358952-2|CAI18902.1|  789|Homo sapiens PR domain containing 1,
           with ZNF domain protein.
          Length = 789

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 269 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 328

Query: 479 PGSAD 493
           PGS +
Sbjct: 329 PGSQE 333


>AL022067-3|CAI42296.1|  789|Homo sapiens PR domain containing 1,
           with ZNF domain protein.
          Length = 789

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 269 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 328

Query: 479 PGSAD 493
           PGS +
Sbjct: 329 PGSQE 333


>AK126796-1|BAC86698.1|  195|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44846 fis, clone BRACE3051144. ).
          Length = 195

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = -3

Query: 322 RHNFRRKVQEYSQVFNTLIG*VPVKVPPGKLFFDITSGLE*LHSFDNLEVRNLL 161
           RH  + ++   +++ +  +G VPV++ PGKL    TSG E L    +++V ++L
Sbjct: 118 RHALQGQMVVIAEILDPHVGEVPVEMSPGKL-LPATSGPERLPGLHDVKVGHIL 170


>AF084199-1|AAC33300.1|  789|Homo sapiens beta-interferon gene
           positive-regulatory domain I binding factor protein.
          Length = 789

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
 Frame = +2

Query: 302 LPPEIVPATLKRSVRTET-VRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVG 478
           LP + + A+L   +   T + R P+     P+ SA          ++P  +P +  + VG
Sbjct: 269 LPEDFLKASLAYGIERPTYITRSPIPSSTTPSPSARSSPDQSLKSSSPHSSPGNTVSPVG 328

Query: 479 PGSAD 493
           PGS +
Sbjct: 329 PGSQE 333


>AB029022-1|BAA83051.2|  864|Homo sapiens KIAA1099 protein protein.
          Length = 864

 Score = 30.7 bits (66), Expect = 3.6
 Identities = 21/57 (36%), Positives = 23/57 (40%)
 Frame = +2

Query: 362 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRGRPA 532
           RGP  R   P  S+   SA RR    PG       A  GP  A    +G  G GR A
Sbjct: 2   RGPAPRLLRPRLSSRASSARRRRARLPGGCGAPGSAARGPRGAGRRRRGARGSGRGA 58


>L04288-1|AAA35734.2| 1462|Homo sapiens cyclophilin-related protein
           protein.
          Length = 1462

 Score = 29.5 bits (63), Expect = 8.4
 Identities = 19/54 (35%), Positives = 23/54 (42%)
 Frame = +2

Query: 332 KRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSAD 493
           KRSV +   R  PV RP+      E+R   RR        P  K  DV P  +D
Sbjct: 268 KRSVDSSAKREKPVVRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDVAPIVSD 321


>BX641127-1|CAE46057.1|  191|Homo sapiens hypothetical protein
           protein.
          Length = 191

 Score = 29.5 bits (63), Expect = 8.4
 Identities = 19/54 (35%), Positives = 23/54 (42%)
 Frame = +2

Query: 332 KRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSAD 493
           KRSV +   R  PV RP+      E+R   RR        P  K  DV P  +D
Sbjct: 15  KRSVDSSAKREKPVVRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDVAPIVSD 68


>BX640751-1|CAE45859.1|  590|Homo sapiens hypothetical protein
           protein.
          Length = 590

 Score = 29.5 bits (63), Expect = 8.4
 Identities = 19/54 (35%), Positives = 23/54 (42%)
 Frame = +2

Query: 332 KRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSAD 493
           KRSV +   R  PV RP+      E+R   RR        P  K  DV P  +D
Sbjct: 15  KRSVDSSAKREKPVVRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDVAPIVSD 68


>AF184110-1|AAD56402.1| 1462|Homo sapiens cyclophilin-related
           protein protein.
          Length = 1462

 Score = 29.5 bits (63), Expect = 8.4
 Identities = 19/54 (35%), Positives = 23/54 (42%)
 Frame = +2

Query: 332 KRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSAD 493
           KRSV +   R  PV RP+      E+R   RR        P  K  DV P  +D
Sbjct: 268 KRSVDSSAKREKPVVRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDVAPIVSD 321


>AB209888-1|BAD93125.1|  317|Homo sapiens natural killer-tumor
           recognition sequence variant protein.
          Length = 317

 Score = 29.5 bits (63), Expect = 8.4
 Identities = 19/54 (35%), Positives = 23/54 (42%)
 Frame = +2

Query: 332 KRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGSAD 493
           KRSV +   R  PV RP+      E+R   RR        P  K  DV P  +D
Sbjct: 148 KRSVDSSAKREKPVVRPEEIPPVPENRFLLRRDMPVVTAEPEPKIPDVAPIVSD 201


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 80,565,448
Number of Sequences: 237096
Number of extensions: 1706240
Number of successful extensions: 5966
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 4992
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5870
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5590411794
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -