SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B13
         (639 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF657398-3|ABR95139.1|  513|Homo sapiens cytochrome c oxidase su...   154   3e-37
EF660954-3|ABR58070.1|  513|Homo sapiens cytochrome c oxidase su...   153   4e-37
DQ272107-3|ABB51244.1|  513|Homo sapiens cytochrome c oxidase su...   153   4e-37
DQ112883-3|AAZ02349.1|  513|Homo sapiens cytochrome c oxidase su...   153   4e-37
AY738974-3|AAU13396.1|  513|Homo sapiens cytochrome c oxidase su...   153   4e-37
AP008837-3|BAE14868.1|  513|Homo sapiens cytochrome oxydase subu...   153   4e-37
AP008492-3|BAE10381.1|  513|Homo sapiens cytochrome oxydase subu...   153   4e-37
EF660941-3|ABR57901.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
EF657599-3|ABR97747.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
EF657506-3|ABR96541.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
EF657390-3|ABR95035.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
EF657314-3|ABR94049.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
DQ523667-3|ABF49356.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
DQ523633-3|ABF48914.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
DQ523629-3|ABF48862.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
DQ305017-3|ABB99117.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
DQ305013-3|ABB99065.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
DQ112814-3|AAZ01452.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
DQ112780-3|AAZ01010.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
AY495115-3|AAR92823.1|  513|Homo sapiens cytochrome c oxidase su...   153   5e-37
AP008896-3|BAE15635.1|  513|Homo sapiens cytochrome oxydase subu...   153   5e-37
AP008776-3|BAE14075.1|  513|Homo sapiens cytochrome oxydase subu...   153   5e-37
AP008278-3|BAE07599.1|  513|Homo sapiens cytochrome oxydase subu...   153   5e-37
EF660975-3|ABR58340.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF660971-3|ABR58291.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF657779-3|ABS00086.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF657731-3|ABR99462.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF657612-3|ABR97916.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF657429-3|ABR95542.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF657237-3|ABR93051.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF645646-3|ABR10799.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF184640-3|ABO39996.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
EF093554-3|ABL61829.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
DQ341075-3|ABC60746.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
DQ304955-3|ABB98311.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
DQ112949-3|AAZ03207.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
DQ112764-3|AAZ00802.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
DQ112699-3|AAY99957.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
AY922254-3|AAX14967.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
AY714021-3|AAU02711.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
AY289087-3|AAP48350.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
AY289072-3|AAP48155.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
AJ842748-3|CAH59667.1|  513|Homo sapiens cytochrome oxidase subu...   153   7e-37
AJ842745-3|CAH59646.1|  513|Homo sapiens cytochrome oxidase subu...   153   7e-37
AF347005-3|AAK17755.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
AF347002-3|AAK17716.1|  513|Homo sapiens cytochrome c oxidase su...   153   7e-37
V00662-3|CAA24028.1|  513|Homo sapiens protein ( H.sapiens mitoc...   152   9e-37
J01415-3|AAB58945.1|  513|Homo sapiens cytochrome oxidase subuni...   152   9e-37
EU089747-3|ABU40228.1|  513|Homo sapiens cytochrome oxidase subu...   152   9e-37
EU089746-3|ABU40215.1|  513|Homo sapiens cytochrome oxidase subu...   152   9e-37
EU086510-3|ABU40202.1|  513|Homo sapiens cytochrome oxidase subu...   152   9e-37
EU080974-3|ABS87630.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU074158-3|ABS84019.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU073971-3|ABS84058.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU073970-3|ABS84045.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU073969-3|ABS84032.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU057183-3|ABS84006.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU052292-3|ABS57632.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU052289-3|ABS57619.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU051827-3|ABS58476.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU049814-3|ABS57606.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007895-3|ABS58463.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007894-3|ABS58450.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007893-3|ABS58437.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007892-3|ABS58424.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007891-3|ABS58411.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007890-3|ABS58398.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007889-3|ABS58385.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007888-3|ABS58372.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007887-3|ABS58359.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007886-3|ABS58346.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007885-3|ABS58333.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007884-3|ABS58320.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007883-3|ABS58307.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007882-3|ABS58294.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007881-3|ABS58281.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007880-3|ABS58268.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007879-3|ABS58255.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007878-3|ABS58242.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007877-3|ABS58229.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007876-3|ABS58216.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007875-3|ABS58203.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007874-3|ABS58190.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007873-3|ABS58177.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007872-3|ABS58164.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007871-3|ABS58151.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007870-3|ABS58138.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007869-3|ABS58125.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007868-3|ABS58112.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007867-3|ABS58099.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007866-3|ABS58086.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007865-3|ABS58073.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007864-3|ABS58060.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007863-3|ABS58047.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007862-3|ABS58034.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007861-3|ABS58021.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007860-3|ABS58008.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007859-3|ABS57995.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007858-3|ABS57982.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007857-3|ABS57969.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007856-3|ABS57956.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007855-3|ABS57943.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007854-3|ABS57930.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007853-3|ABS57917.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007852-3|ABS57904.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007851-3|ABS57891.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007850-3|ABS57878.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007849-3|ABS57865.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007848-3|ABS57852.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007847-3|ABS57839.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007846-3|ABS57826.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007845-3|ABS57813.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007844-3|ABS57800.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007843-3|ABS57787.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007842-3|ABS57774.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007841-3|ABS57761.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007840-3|ABS57748.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007839-3|ABS57735.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007838-3|ABS57722.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007837-3|ABS57709.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007836-3|ABS57696.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EU007835-3|ABS57683.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF692533-3|ABR57512.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661013-2|ABR58824.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661012-3|ABR58812.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661011-3|ABR58799.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661010-3|ABR58786.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661009-3|ABR58773.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661008-3|ABR58760.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661007-3|ABR58747.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661006-3|ABR58734.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661005-3|ABR58722.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661004-3|ABR58709.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661003-3|ABR58696.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661002-3|ABR58684.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661001-3|ABR58672.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF661000-2|ABR58659.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660999-3|ABR58647.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660998-3|ABR58634.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660997-3|ABR58621.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660996-3|ABR58609.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660995-3|ABR58597.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660994-3|ABR58585.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660993-2|ABR58572.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660992-3|ABR58560.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660991-3|ABR58547.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660990-3|ABR58534.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660989-3|ABR58521.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660988-2|ABR58508.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660987-3|ABR58496.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660986-3|ABR58483.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660985-3|ABR58470.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660984-3|ABR58457.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660983-3|ABR58444.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660982-3|ABR58431.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660981-3|ABR58418.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660980-3|ABR58405.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660979-3|ABR58392.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660978-3|ABR58379.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660976-3|ABR58353.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660974-3|ABR58327.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660973-3|ABR58314.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660972-2|ABR58303.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660970-3|ABR58278.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660969-3|ABR58265.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660968-3|ABR58252.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660967-3|ABR58239.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660966-3|ABR58226.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660965-3|ABR58213.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660964-3|ABR58200.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660963-3|ABR58187.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660962-3|ABR58174.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660961-3|ABR58161.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660960-3|ABR58148.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660959-3|ABR58135.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660958-3|ABR58122.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660957-3|ABR58109.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660956-3|ABR58096.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660955-3|ABR58083.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660953-3|ABR58057.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660952-3|ABR58044.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660951-3|ABR58031.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660950-3|ABR58018.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660949-3|ABR58005.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660948-3|ABR57992.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660947-3|ABR57979.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660946-3|ABR57966.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660945-3|ABR57953.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660944-3|ABR57940.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660943-3|ABR57927.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660942-3|ABR57914.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660940-3|ABR57888.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660939-3|ABR57875.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660938-3|ABR57862.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660937-3|ABR57849.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660936-3|ABR57836.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660935-3|ABR57823.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660934-3|ABR57810.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660933-3|ABR57797.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660932-3|ABR57784.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660931-3|ABR57771.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660930-3|ABR57759.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660929-3|ABR57746.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660928-3|ABR57733.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660927-3|ABR57720.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660926-3|ABR57707.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660925-3|ABR57694.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660924-3|ABR57681.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660923-3|ABR57668.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660922-3|ABR57655.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660921-3|ABR57642.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660920-3|ABR57629.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660919-3|ABR57616.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660918-3|ABR57603.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660917-3|ABR57590.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660916-3|ABR57577.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660915-3|ABR57564.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660914-3|ABR57551.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660913-3|ABR57538.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF660912-3|ABR57525.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657790-3|ABS00229.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657789-3|ABS00216.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657788-3|ABS00203.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657787-3|ABS00190.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657786-3|ABS00177.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657785-3|ABS00164.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657784-3|ABS00151.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657783-3|ABS00138.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657782-3|ABS00125.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657781-3|ABS00112.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657780-3|ABS00099.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657778-3|ABS00073.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657777-3|ABS00060.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657776-3|ABS00047.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657775-3|ABS00034.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657774-3|ABS00021.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657773-3|ABS00008.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657772-3|ABR99994.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657771-3|ABR99981.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657770-3|ABR99968.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657769-3|ABR99955.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657768-3|ABR99942.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657767-3|ABR99929.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657766-3|ABR99916.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657765-3|ABR99903.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657764-3|ABR99890.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657763-3|ABR99877.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657762-3|ABR99864.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657761-3|ABR99851.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657760-3|ABR99838.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657759-3|ABR99825.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657758-3|ABR99812.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657757-3|ABR99799.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657756-3|ABR99786.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657755-3|ABR99773.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657754-3|ABR99760.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657753-3|ABR99747.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657752-3|ABR99734.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657751-3|ABR99721.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657750-3|ABR99708.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657749-3|ABR99695.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657748-3|ABR99682.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657746-3|ABR99657.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657744-3|ABR99631.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657743-3|ABR99618.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657742-3|ABR99605.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657741-3|ABR99592.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657740-3|ABR99579.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657739-3|ABR99566.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657738-3|ABR99553.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657737-3|ABR99540.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657736-3|ABR99527.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657735-3|ABR99514.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657734-3|ABR99501.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657733-3|ABR99488.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657732-3|ABR99475.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657730-3|ABR99449.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657729-3|ABR99436.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657728-3|ABR99423.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657727-3|ABR99410.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657725-3|ABR99384.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657724-3|ABR99371.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657723-3|ABR99358.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657722-3|ABR99345.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657721-3|ABR99332.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657720-3|ABR99319.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657719-3|ABR99306.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657718-3|ABR99293.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657717-3|ABR99280.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657716-3|ABR99267.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657715-3|ABR99254.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657714-3|ABR99241.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657713-3|ABR99228.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657712-3|ABR99215.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657711-3|ABR99202.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657710-3|ABR99189.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657709-3|ABR99176.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657708-3|ABR99163.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657707-3|ABR99150.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657706-3|ABR99137.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657705-3|ABR99124.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657704-3|ABR99111.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657703-3|ABR99098.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657702-3|ABR99085.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657701-3|ABR99072.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657700-3|ABR99059.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657699-3|ABR99046.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657698-3|ABR99033.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657697-3|ABR99020.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657696-3|ABR99007.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657695-3|ABR98994.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657694-3|ABR98981.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657693-3|ABR98968.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657692-2|ABR98955.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657691-3|ABR98943.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657690-3|ABR98930.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657689-3|ABR98917.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657688-3|ABR98904.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657687-3|ABR98891.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657686-3|ABR98878.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657685-3|ABR98865.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657684-3|ABR98852.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657683-3|ABR98839.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657682-3|ABR98826.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657681-3|ABR98813.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657680-3|ABR98800.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657679-3|ABR98787.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657678-3|ABR98774.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657677-3|ABR98761.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657676-3|ABR98748.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657675-3|ABR98735.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657674-3|ABR98722.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657673-3|ABR98709.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657672-3|ABR98696.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657671-3|ABR98683.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657670-3|ABR98670.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657669-3|ABR98657.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657668-3|ABR98644.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657667-3|ABR98631.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657666-3|ABR98618.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657665-3|ABR98605.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657664-3|ABR98592.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657663-3|ABR98579.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657662-3|ABR98566.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657661-3|ABR98553.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657660-3|ABR98540.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657659-3|ABR98527.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657658-3|ABR98514.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657657-3|ABR98501.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657656-3|ABR98488.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657655-3|ABR98475.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657654-3|ABR98462.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657653-3|ABR98449.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657652-3|ABR98436.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657651-3|ABR98423.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657650-3|ABR98410.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657649-3|ABR98397.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657648-3|ABR98384.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657647-3|ABR98371.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657646-3|ABR98358.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657645-3|ABR98345.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657644-3|ABR98332.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657643-3|ABR98319.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657642-3|ABR98306.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657641-3|ABR98293.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657640-3|ABR98280.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657639-3|ABR98267.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657638-3|ABR98254.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657637-3|ABR98241.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657636-3|ABR98228.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657635-3|ABR98215.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657634-3|ABR98202.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657633-3|ABR98189.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657632-3|ABR98176.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657631-3|ABR98163.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657630-3|ABR98150.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657629-3|ABR98137.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657628-3|ABR98124.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657627-3|ABR98111.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657626-3|ABR98098.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657625-3|ABR98085.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657624-3|ABR98072.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657623-3|ABR98059.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657622-3|ABR98046.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657621-3|ABR98033.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657620-3|ABR98020.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657619-3|ABR98007.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657618-3|ABR97994.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657617-3|ABR97981.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657616-3|ABR97968.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657615-3|ABR97955.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657614-3|ABR97942.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657613-3|ABR97929.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657611-3|ABR97903.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657610-3|ABR97890.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657609-3|ABR97877.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657608-3|ABR97864.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657607-3|ABR97851.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657606-3|ABR97838.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657605-3|ABR97825.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657604-3|ABR97812.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657603-3|ABR97799.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657602-3|ABR97786.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657601-3|ABR97773.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657600-3|ABR97760.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657598-3|ABR97734.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657597-3|ABR97721.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657596-3|ABR97708.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657595-3|ABR97695.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657593-3|ABR97670.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657592-3|ABR97657.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657591-3|ABR97644.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657590-3|ABR97631.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657589-3|ABR97618.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657588-3|ABR97605.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657587-3|ABR97592.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657586-3|ABR97579.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657585-3|ABR97566.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657584-3|ABR97553.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657583-3|ABR97540.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657582-3|ABR97527.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657581-3|ABR97514.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657579-3|ABR97488.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657578-3|ABR97475.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657577-3|ABR97462.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657576-3|ABR97449.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657575-3|ABR97436.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657574-3|ABR97423.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657573-3|ABR97410.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657572-3|ABR97397.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657571-3|ABR97384.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657570-3|ABR97371.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657569-3|ABR97358.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657568-3|ABR97345.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657567-3|ABR97332.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657566-3|ABR97319.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657565-3|ABR97306.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657564-3|ABR97293.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657563-3|ABR97280.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657562-3|ABR97267.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657561-3|ABR97254.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657560-3|ABR97241.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657559-3|ABR97228.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657558-3|ABR97215.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657557-3|ABR97202.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657556-3|ABR97189.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657555-3|ABR97176.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657554-3|ABR97163.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657553-3|ABR97150.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657552-3|ABR97137.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657551-3|ABR97124.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657550-3|ABR97111.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657549-2|ABR97098.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657548-3|ABR97086.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657547-3|ABR97073.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657546-3|ABR97060.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657545-3|ABR97047.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657544-3|ABR97034.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657543-3|ABR97021.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657542-3|ABR97008.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657541-2|ABR96995.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657540-3|ABR96983.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657539-3|ABR96970.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657538-3|ABR96957.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657537-3|ABR96944.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657536-3|ABR96931.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657535-3|ABR96918.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657534-3|ABR96905.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657533-3|ABR96892.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657532-3|ABR96879.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657531-3|ABR96866.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657530-3|ABR96853.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657529-3|ABR96840.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657528-3|ABR96827.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657527-3|ABR96814.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657526-3|ABR96801.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657525-3|ABR96788.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657524-3|ABR96775.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657523-3|ABR96762.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657521-3|ABR96736.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657520-3|ABR96723.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657519-3|ABR96710.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657518-3|ABR96697.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657517-3|ABR96684.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657516-3|ABR96671.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657515-3|ABR96658.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657514-3|ABR96645.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657513-3|ABR96632.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657512-3|ABR96619.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657511-3|ABR96606.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657510-3|ABR96593.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657509-3|ABR96580.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657508-3|ABR96567.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657507-3|ABR96554.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657505-3|ABR96528.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657504-3|ABR96515.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657503-3|ABR96502.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657502-3|ABR96489.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657501-3|ABR96476.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37
EF657500-3|ABR96463.1|  513|Homo sapiens cytochrome c oxidase su...   152   9e-37

>EF657398-3|ABR95139.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  154 bits (373), Expect = 3e-37
 Identities = 86/181 (47%), Positives = 102/181 (56%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDLAIFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLAIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660954-3|ABR58070.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (372), Expect = 4e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PGSL+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGSLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ272107-3|ABB51244.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (372), Expect = 4e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PGSL+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGSLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ112883-3|AAZ02349.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (372), Expect = 4e-37
 Identities = 85/181 (46%), Positives = 102/181 (56%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q+PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQMPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AY738974-3|AAU13396.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (372), Expect = 4e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PGSL+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGSLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AP008837-3|BAE14868.1|  513|Homo sapiens cytochrome oxydase subunit
           I protein.
          Length = 513

 Score =  153 bits (372), Expect = 4e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PGSL+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGSLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASTMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AP008492-3|BAE10381.1|  513|Homo sapiens cytochrome oxydase subunit
           I protein.
          Length = 513

 Score =  153 bits (372), Expect = 4e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PGSL+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGSLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660941-3|ABR57901.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657599-3|ABR97747.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657506-3|ABR96541.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657390-3|ABR95035.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657314-3|ABR94049.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ523667-3|ABF49356.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ523633-3|ABF48914.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ523629-3|ABF48862.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ305017-3|ABB99117.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ305013-3|ABB99065.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ112814-3|AAZ01452.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ112780-3|AAZ01010.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AY495115-3|AAR92823.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDVAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AP008896-3|BAE15635.1|  513|Homo sapiens cytochrome oxydase subunit
           I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AP008776-3|BAE14075.1|  513|Homo sapiens cytochrome oxydase subunit
           I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AP008278-3|BAE07599.1|  513|Homo sapiens cytochrome oxydase subunit
           I protein.
          Length = 513

 Score =  153 bits (371), Expect = 5e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVETGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660975-3|ABR58340.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660971-3|ABR58291.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657779-3|ABS00086.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657731-3|ABR99462.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657612-3|ABR97916.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657429-3|ABR95542.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657237-3|ABR93051.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF645646-3|ABR10799.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF184640-3|ABO39996.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF093554-3|ABL61829.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ341075-3|ABC60746.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ304955-3|ABB98311.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ112949-3|AAZ03207.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ112764-3|AAZ00802.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>DQ112699-3|AAY99957.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AY922254-3|AAX14967.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AY714021-3|AAU02711.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AY289087-3|AAP48350.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AY289072-3|AAP48155.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AJ842748-3|CAH59667.1|  513|Homo sapiens cytochrome oxidase subunit
           I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AJ842745-3|CAH59646.1|  513|Homo sapiens cytochrome oxidase subunit
           I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AF347005-3|AAK17755.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>AF347002-3|AAK17716.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  153 bits (370), Expect = 7e-37
 Identities = 86/181 (47%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAGISS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGTSVDLTIFSLHLAGISS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>V00662-3|CAA24028.1|  513|Homo sapiens protein ( H.sapiens
           mitochondrial genome. ).
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>J01415-3|AAB58945.1|  513|Homo sapiens cytochrome oxidase subunit 1
           protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU089747-3|ABU40228.1|  513|Homo sapiens cytochrome oxidase subunit
           I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU089746-3|ABU40215.1|  513|Homo sapiens cytochrome oxidase subunit
           I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU086510-3|ABU40202.1|  513|Homo sapiens cytochrome oxidase subunit
           I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU080974-3|ABS87630.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU074158-3|ABS84019.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU073971-3|ABS84058.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU073970-3|ABS84045.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU073969-3|ABS84032.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU057183-3|ABS84006.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU052292-3|ABS57632.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU052289-3|ABS57619.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU051827-3|ABS58476.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU049814-3|ABS57606.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007895-3|ABS58463.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007894-3|ABS58450.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007893-3|ABS58437.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007892-3|ABS58424.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007891-3|ABS58411.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007890-3|ABS58398.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007889-3|ABS58385.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007888-3|ABS58372.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007887-3|ABS58359.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007886-3|ABS58346.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007885-3|ABS58333.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007884-3|ABS58320.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007883-3|ABS58307.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007882-3|ABS58294.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007881-3|ABS58281.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007880-3|ABS58268.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007879-3|ABS58255.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007878-3|ABS58242.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007877-3|ABS58229.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007876-3|ABS58216.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007875-3|ABS58203.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007874-3|ABS58190.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007873-3|ABS58177.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007872-3|ABS58164.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007871-3|ABS58151.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007870-3|ABS58138.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007869-3|ABS58125.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007868-3|ABS58112.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007867-3|ABS58099.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007866-3|ABS58086.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007865-3|ABS58073.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007864-3|ABS58060.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007863-3|ABS58047.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007862-3|ABS58034.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007861-3|ABS58021.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007860-3|ABS58008.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007859-3|ABS57995.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007858-3|ABS57982.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007857-3|ABS57969.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007856-3|ABS57956.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007855-3|ABS57943.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007854-3|ABS57930.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007853-3|ABS57917.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007852-3|ABS57904.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007851-3|ABS57891.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007850-3|ABS57878.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007849-3|ABS57865.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007848-3|ABS57852.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007847-3|ABS57839.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007846-3|ABS57826.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007845-3|ABS57813.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007844-3|ABS57800.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007843-3|ABS57787.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007842-3|ABS57774.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007841-3|ABS57761.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007840-3|ABS57748.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007839-3|ABS57735.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007838-3|ABS57722.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007837-3|ABS57709.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007836-3|ABS57696.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EU007835-3|ABS57683.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF692533-3|ABR57512.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661013-2|ABR58824.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661012-3|ABR58812.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661011-3|ABR58799.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661010-3|ABR58786.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661009-3|ABR58773.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661008-3|ABR58760.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661007-3|ABR58747.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661006-3|ABR58734.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661005-3|ABR58722.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661004-3|ABR58709.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661003-3|ABR58696.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661002-3|ABR58684.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661001-3|ABR58672.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF661000-2|ABR58659.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660999-3|ABR58647.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660998-3|ABR58634.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660997-3|ABR58621.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660996-3|ABR58609.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660995-3|ABR58597.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660994-3|ABR58585.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660993-2|ABR58572.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660992-3|ABR58560.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660991-3|ABR58547.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660990-3|ABR58534.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660989-3|ABR58521.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660988-2|ABR58508.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660987-3|ABR58496.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660986-3|ABR58483.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660985-3|ABR58470.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660984-3|ABR58457.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660983-3|ABR58444.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660982-3|ABR58431.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660981-3|ABR58418.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660980-3|ABR58405.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660979-3|ABR58392.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660978-3|ABR58379.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660976-3|ABR58353.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660974-3|ABR58327.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660973-3|ABR58314.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660972-2|ABR58303.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660970-3|ABR58278.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660969-3|ABR58265.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660968-3|ABR58252.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660967-3|ABR58239.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660966-3|ABR58226.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660965-3|ABR58213.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660964-3|ABR58200.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660963-3|ABR58187.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660962-3|ABR58174.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660961-3|ABR58161.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660960-3|ABR58148.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660959-3|ABR58135.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660958-3|ABR58122.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660957-3|ABR58109.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660956-3|ABR58096.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660955-3|ABR58083.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660953-3|ABR58057.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660952-3|ABR58044.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660951-3|ABR58031.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660950-3|ABR58018.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660949-3|ABR58005.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660948-3|ABR57992.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660947-3|ABR57979.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660946-3|ABR57966.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660945-3|ABR57953.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660944-3|ABR57940.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660943-3|ABR57927.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660942-3|ABR57914.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660940-3|ABR57888.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660939-3|ABR57875.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660938-3|ABR57862.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660937-3|ABR57849.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660936-3|ABR57836.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660935-3|ABR57823.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660934-3|ABR57810.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660933-3|ABR57797.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660932-3|ABR57784.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660931-3|ABR57771.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660930-3|ABR57759.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660929-3|ABR57746.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660928-3|ABR57733.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660927-3|ABR57720.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660926-3|ABR57707.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660925-3|ABR57694.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660924-3|ABR57681.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660923-3|ABR57668.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660922-3|ABR57655.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660921-3|ABR57642.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660920-3|ABR57629.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660919-3|ABR57616.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660918-3|ABR57603.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660917-3|ABR57590.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660916-3|ABR57577.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660915-3|ABR57564.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660914-3|ABR57551.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660913-3|ABR57538.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF660912-3|ABR57525.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657790-3|ABS00229.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657789-3|ABS00216.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657788-3|ABS00203.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657787-3|ABS00190.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657786-3|ABS00177.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657785-3|ABS00164.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657784-3|ABS00151.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657783-3|ABS00138.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657782-3|ABS00125.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657781-3|ABS00112.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657780-3|ABS00099.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657778-3|ABS00073.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657777-3|ABS00060.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657776-3|ABS00047.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657775-3|ABS00034.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657774-3|ABS00021.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657773-3|ABS00008.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657772-3|ABR99994.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657771-3|ABR99981.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657770-3|ABR99968.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657769-3|ABR99955.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657768-3|ABR99942.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657767-3|ABR99929.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657766-3|ABR99916.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657765-3|ABR99903.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657764-3|ABR99890.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657763-3|ABR99877.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657762-3|ABR99864.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657761-3|ABR99851.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLILSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


>EF657760-3|ABR99838.1|  513|Homo sapiens cytochrome c oxidase
           subunit I protein.
          Length = 513

 Score =  152 bits (369), Expect = 9e-37
 Identities = 85/181 (46%), Positives = 101/181 (55%)
 Frame = +2

Query: 95  RAELGNPGSLIGDXQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 274
           RAELG PG+L+G+  IYN IVTAHA                 N LVPL++GAPD+AFPR+
Sbjct: 38  RAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRM 97

Query: 275 NNIRFXXXXXXXXXXXXXXIVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 454
           NN+ F              +VE GAGTG TVYPPL+ N +H G SVDL IFSLHLAG+SS
Sbjct: 98  NNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSS 157

Query: 455 XXXXXXXXXXXXXXXXXXXSFDQLPLFV*AVGITAFXXXXXXXXXAGAITILLTDRNLNT 634
                              +  Q PLFV +V ITA          A  IT+LLTDRNLNT
Sbjct: 158 ILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNT 217

Query: 635 S 637
           +
Sbjct: 218 T 218



 Score = 30.7 bits (66), Expect = 4.6
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 1  IYSTNHKXIGTLYFIF 48
          ++STNHK IGTLY +F
Sbjct: 7  LFSTNHKDIGTLYLLF 22


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 62,803,001
Number of Sequences: 237096
Number of extensions: 973433
Number of successful extensions: 16271
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 5283
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8951
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7028963750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -