SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L11567-1|AAA62148.1|   97|Homo sapiens ribosomal protein L37 pro...   111   8e-25
D23661-1|BAA04888.1|   97|Homo sapiens ribosomal protein L37 pro...   111   8e-25
CR456890-1|CAG33171.1|   97|Homo sapiens RPL37 protein.               111   8e-25
BC084576-1|AAH84576.1|   97|Homo sapiens RPL37 protein protein.       111   8e-25
BC079477-1|AAH79477.1|   97|Homo sapiens ribosomal protein L37 p...   111   8e-25
AB061834-1|BAB79472.1|   97|Homo sapiens ribosomal protein L37 p...   111   8e-25
S79979-1|AAB47039.2|   97|Homo sapiens ribosomal protein L37 pro...   109   4e-24
AB007183-1|BAA25842.1|   27|Homo sapiens ribosomal protein L37 p...    31   1.4  
AL355305-3|CAI14559.1|  436|Homo sapiens protein ( Human DNA seq...    29   4.4  
AL355305-2|CAI14560.1|  360|Homo sapiens protein ( Human DNA seq...    29   4.4  

>L11567-1|AAA62148.1|   97|Homo sapiens ribosomal protein L37
           protein.
          Length = 97

 Score =  111 bits (267), Expect = 8e-25
 Identities = 49/82 (59%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCG  +YH+QKS C +CGYPA + R Y+WS KA          MRHLKIV R
Sbjct: 13  NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RFR+GF+EG  P P + AVA+S
Sbjct: 73  RFRHGFREGTTPKPKRAAVAAS 94


>D23661-1|BAA04888.1|   97|Homo sapiens ribosomal protein L37
           protein.
          Length = 97

 Score =  111 bits (267), Expect = 8e-25
 Identities = 49/82 (59%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCG  +YH+QKS C +CGYPA + R Y+WS KA          MRHLKIV R
Sbjct: 13  NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RFR+GF+EG  P P + AVA+S
Sbjct: 73  RFRHGFREGTTPKPKRAAVAAS 94


>CR456890-1|CAG33171.1|   97|Homo sapiens RPL37 protein.
          Length = 97

 Score =  111 bits (267), Expect = 8e-25
 Identities = 49/82 (59%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCG  +YH+QKS C +CGYPA + R Y+WS KA          MRHLKIV R
Sbjct: 13  NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RFR+GF+EG  P P + AVA+S
Sbjct: 73  RFRHGFREGTTPKPKRAAVAAS 94


>BC084576-1|AAH84576.1|   97|Homo sapiens RPL37 protein protein.
          Length = 97

 Score =  111 bits (267), Expect = 8e-25
 Identities = 49/82 (59%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCG  +YH+QKS C +CGYPA + R Y+WS KA          MRHLKIV R
Sbjct: 13  NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RFR+GF+EG  P P + AVA+S
Sbjct: 73  RFRHGFREGTTPKPKRAAVAAS 94


>BC079477-1|AAH79477.1|   97|Homo sapiens ribosomal protein L37
           protein.
          Length = 97

 Score =  111 bits (267), Expect = 8e-25
 Identities = 49/82 (59%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCG  +YH+QKS C +CGYPA + R Y+WS KA          MRHLKIV R
Sbjct: 13  NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RFR+GF+EG  P P + AVA+S
Sbjct: 73  RFRHGFREGTTPKPKRAAVAAS 94


>AB061834-1|BAB79472.1|   97|Homo sapiens ribosomal protein L37
           protein.
          Length = 97

 Score =  111 bits (267), Expect = 8e-25
 Identities = 49/82 (59%), Positives = 58/82 (70%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCG  +YH+QKS C +CGYPA + R Y+WS KA          MRHLKIV R
Sbjct: 13  NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RFR+GF+EG  P P + AVA+S
Sbjct: 73  RFRHGFREGTTPKPKRAAVAAS 94


>S79979-1|AAB47039.2|   97|Homo sapiens ribosomal protein L37
           protein.
          Length = 97

 Score =  109 bits (261), Expect = 4e-24
 Identities = 48/82 (58%), Positives = 57/82 (69%), Gaps = 1/82 (1%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCG  +YH+QKS C +CGYPA + R Y+WS KA          M HLKIV R
Sbjct: 13  NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMSHLKIVYR 72

Query: 248 RFRNGFKEG-KPTPPKKAVASS 310
           RFR+GF+EG  P P + AVA+S
Sbjct: 73  RFRHGFREGTTPKPKRAAVAAS 94


>AB007183-1|BAA25842.1|   27|Homo sapiens ribosomal protein L37
           protein.
          Length = 27

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/27 (51%), Positives = 15/27 (55%)
 Frame = +2

Query: 173 HWSVKAXXXXXXXXXXMRHLKIVRRRF 253
           +WS KA          MRHLKIV RRF
Sbjct: 1   NWSAKAKRRNTTGTGRMRHLKIVYRRF 27


>AL355305-3|CAI14559.1|  436|Homo sapiens protein ( Human DNA
           sequence from clone RP11-487F23 on chromosome 6. ).
          Length = 436

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +1

Query: 124 IKMRPMWISCSKITILPLVSEG*AQEDYW 210
           IK RP W  CSK   LP V+E  ++   W
Sbjct: 253 IKRRPPWQICSKFGALPFVAEKPSRTTSW 281


>AL355305-2|CAI14560.1|  360|Homo sapiens protein ( Human DNA
           sequence from clone RP11-487F23 on chromosome 6. ).
          Length = 360

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +1

Query: 124 IKMRPMWISCSKITILPLVSEG*AQEDYW 210
           IK RP W  CSK   LP V+E  ++   W
Sbjct: 177 IKRRPPWQICSKFGALPFVAEKPSRTTSW 205


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,018,640
Number of Sequences: 237096
Number of extensions: 875287
Number of successful extensions: 1645
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1639
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1645
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2928276690
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -