SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X63237-1|CAA44911.1|  156|Homo sapiens ubiquitin protein.             223   4e-58
S79522-1|AAB21188.1|  156|Homo sapiens ubiquitin carboxyl extens...   223   4e-58
BC066293-1|AAH66293.1|  156|Homo sapiens ribosomal protein S27a ...   223   4e-58
BC001392-1|AAH01392.1|  156|Homo sapiens ribosomal protein S27a ...   223   4e-58
BC053371-1|AAH53371.1|  156|Homo sapiens ribosomal protein S27a ...   219   5e-57
M10939-1|AAA36788.1|  152|Homo sapiens protein ( Human ubiquitin...   215   1e-55
AB061854-1|BAB79488.1|  121|Homo sapiens ribosomal protein S27A ...   154   3e-37
X56999-1|CAA40314.1|  128|Homo sapiens ubiquitin-52 amino acid  ...   141   2e-33
X56998-1|CAA40313.1|  128|Homo sapiens ubiquitin-52 amino acid  ...   141   2e-33
X56997-1|CAA40312.1|  128|Homo sapiens ubiquitin-52 amino acid f...   141   2e-33
X04803-1|CAA28495.1|  229|Homo sapiens ubiquitin protein.             141   2e-33
M26880-1|AAA36789.1|  685|Homo sapiens protein ( Human ubiquitin...   141   2e-33
M17597-1|AAA36787.1|  269|Homo sapiens protein ( Human poly-ubiq...   141   2e-33
D63791-1|BAA09860.1|  611|Homo sapiens polyubiquitin protein.         141   2e-33
DQ479851-1|ABE96835.1|  128|Homo sapiens ubiquitin A-52 residue ...   141   2e-33
BT020104-1|AAV38907.1|  229|Homo sapiens ubiquitin B protein.         141   2e-33
BC101832-1|AAI01833.1|  128|Homo sapiens ubiquitin A-52 residue ...   141   2e-33
BC101830-1|AAI01831.1|  128|Homo sapiens ubiquitin A-52 residue ...   141   2e-33
BC080583-1|AAH80583.1|  698|Homo sapiens Unknown (protein for IM...   141   2e-33
BC046123-1|AAH46123.1|  229|Homo sapiens ubiquitin B protein.         141   2e-33
BC039193-1|AAH39193.1|  685|Homo sapiens ubiquitin C protein.         141   2e-33
BC038999-1|AAH38999.1|  229|Homo sapiens ubiquitin B protein.         141   2e-33
BC031027-1|AAH31027.1|  229|Homo sapiens ubiquitin B protein.         141   2e-33
BC026301-1|AAH26301.1|  229|Homo sapiens ubiquitin B protein.         141   2e-33
BC015127-1|AAH15127.1|  229|Homo sapiens ubiquitin B protein.         141   2e-33
BC014880-1|AAH14880.1|  305|Homo sapiens UBC protein protein.         141   2e-33
BC009301-1|AAH09301.1|  229|Homo sapiens ubiquitin B protein.         141   2e-33
BC008955-1|AAH08955.2|  546|Homo sapiens UBC protein protein.         141   2e-33
BC000379-1|AAH00379.1|  229|Homo sapiens ubiquitin B protein.         141   2e-33
AY819759-1|AAV68344.1|  229|Homo sapiens ubiquitin C splice vari...   141   2e-33
AY732488-1|AAV33127.1|  153|Homo sapiens ubiquitin C splice vari...   141   2e-33
AL117514-1|CAB55973.1|  239|Homo sapiens hypothetical protein pr...   141   2e-33
AK056939-1|BAB71316.1|  388|Homo sapiens protein ( Homo sapiens ...   141   2e-33
AF348700-1|AAK31162.1|  141|Homo sapiens ubiquitin A-52 residue ...   141   2e-33
AC005253-2|AAC25582.1|  128|Homo sapiens ubiquitin-52 amino acid...   141   2e-33
AB209782-1|BAD93019.1| 1309|Homo sapiens ubiquitin C variant pro...   141   2e-33
AB089617-1|BAC56955.1|  229|Homo sapiens polyubiquitin B protein.     141   2e-33
AB089613-1|BAC56951.1|  685|Homo sapiens polyubiquitin C protein.     141   2e-33
AB009010-1|BAA23632.1|  685|Homo sapiens polyubiquitin UbC protein.   141   2e-33
AB003730-1|BAA23486.1|  609|Homo sapiens polyubiquitin protein.       141   2e-33
AK127995-1|BAC87221.1|  186|Homo sapiens protein ( Homo sapiens ...   139   7e-33
BC042362-1|AAH42362.1|   95|Homo sapiens RPS27A protein protein.      127   3e-29
D23662-1|BAA04889.1|   81|Homo sapiens ubiquitin-like protein pr...    88   2e-17
BC104664-1|AAI04665.1|   81|Homo sapiens neural precursor cell e...    88   2e-17
BC104201-1|AAI04202.1|   81|Homo sapiens neural precursor cell e...    88   2e-17
BC104200-1|AAI04201.1|   81|Homo sapiens neural precursor cell e...    88   2e-17
CR407662-1|CAG28590.1|   81|Homo sapiens NEDD8 protein.                88   3e-17
AB007163-1|BAA25826.1|   51|Homo sapiens ribosomal protein S27a ...    83   8e-16
AB062071-1|BAB79490.1|   34|Homo sapiens ribosomal protein S27a ...    71   4e-12
Y00361-1|CAA68439.1|   89|Homo sapiens ubiquitin precursor protein.    64   3e-10
BC045587-1|AAH45587.2|  727|Homo sapiens ANUBL1 protein protein.       64   4e-10
AL445201-5|CAH72970.1|  115|Homo sapiens AN1, ubiquitin-like, ho...    64   4e-10
AL445201-4|CAH72968.1|  224|Homo sapiens AN1, ubiquitin-like, ho...    64   4e-10
AL445201-3|CAH72967.1|  727|Homo sapiens AN1, ubiquitin-like, ho...    64   4e-10
AF311324-1|AAG33850.1|  727|Homo sapiens ubiquitin-like fusion p...    64   4e-10
L44140-7|AAA92650.1|  157|Homo sapiens protein ( , complete cds'...    63   7e-10
J03589-1|AAA36790.1|  157|Homo sapiens protein ( Human ubiquitin...    63   7e-10
BX664739-2|CAI43235.1|  157|Homo sapiens ubiquitin-like 4 protein.     63   7e-10
BX664739-1|CAI43234.1|  180|Homo sapiens ubiquitin-like 4 protein.     63   7e-10
BC053589-1|AAH53589.1|  157|Homo sapiens ubiquitin-like 4A protein.    63   7e-10
BC043346-1|AAH43346.1|  157|Homo sapiens ubiquitin-like 4A protein.    63   7e-10
AF063611-1|AAD28541.1|  513|Homo sapiens 2'-5'oligoadenylate syn...    56   1e-07
BC117410-1|AAI17411.1|  514|Homo sapiens 2'-5'-oligoadenylate sy...    54   4e-07
BC117408-1|AAI17409.1|  514|Homo sapiens 2'-5'-oligoadenylate sy...    54   4e-07
AJ225089-1|CAA12396.1|  514|Homo sapiens 2'-5' oligoadenylate sy...    54   4e-07
EF560733-1|ABQ59043.1|  793|Homo sapiens UHRF1 protein protein.        51   3e-06
BC113875-1|AAI13876.2|  806|Homo sapiens ubiquitin-like, contain...    51   3e-06
AY787925-1|AAV40831.1|  793|Homo sapiens ubiquitin-like, contain...    51   3e-06
AF274048-1|AAK55744.1|  793|Homo sapiens nuclear zinc finger pro...    51   3e-06
AF129507-1|AAF28469.1|  793|Homo sapiens transcription factor IC...    51   3e-06
AB177624-1|BAF36720.1|  793|Homo sapiens hNP95 protein.                51   3e-06
AB177623-1|BAF36719.1|  793|Homo sapiens hNP95 protein.                51   3e-06
D21090-1|BAA04652.1|  409|Homo sapiens XP-C repair complementing...    51   4e-06
BC020973-1|AAH20973.1|  409|Homo sapiens RAD23B protein protein.       51   4e-06
AY165178-1|AAN47194.1|  409|Homo sapiens RAD23 homolog B (S. cer...    51   4e-06
AL137852-2|CAD13275.1|  409|Homo sapiens RAD23 homolog B (S. cer...    51   4e-06
AL137852-1|CAH70394.1|  146|Homo sapiens RAD23 homolog B (S. cer...    51   4e-06
AK223479-1|BAD97199.1|  409|Homo sapiens UV excision repair prot...    51   4e-06
Y12653-1|CAA73200.1|  165|Homo sapiens diubiquitin protein.            50   1e-05
BX000688-3|CAI18599.1|  165|Homo sapiens ubiquitin D protein.          50   1e-05
BC012472-1|AAH12472.1|  165|Homo sapiens ubiquitin D protein.          50   1e-05
AL662826-3|CAI17384.1|  165|Homo sapiens ubiquitin D protein.          50   1e-05
AL645936-2|CAI18010.1|  165|Homo sapiens ubiquitin D protein.          50   1e-05
AL031983-3|CAA21458.1|  165|Homo sapiens ubiquitin D protein.          50   1e-05
AF123050-1|AAD52982.1|  165|Homo sapiens ubiquitin-like protein ...    50   1e-05
BC007331-1|AAH07331.1|  227|Homo sapiens ubiquitin domain contai...    49   1e-05
AL359388-3|CAI14191.1|  227|Homo sapiens ubiquitin domain contai...    49   1e-05
AK021869-1|BAB13921.1|  227|Homo sapiens protein ( Homo sapiens ...    49   1e-05
AK222597-1|BAD96317.1|  227|Homo sapiens ubiquitin domain contai...    48   3e-05
BC028397-1|AAH28397.1|  503|Homo sapiens UHRF2 protein protein.        48   4e-05
AL353718-4|CAH74119.1|  802|Homo sapiens ubiquitin-like, contain...    48   4e-05
AL133480-6|CAI13294.1|  136|Homo sapiens ubiquitin-like, contain...    48   4e-05
AL133480-5|CAI13293.1|  802|Homo sapiens ubiquitin-like, contain...    48   4e-05
AF274049-1|AAM33799.1|  802|Homo sapiens nuclear zinc finger pro...    48   4e-05
AB071698-1|BAB68317.1|  802|Homo sapiens Np95-like ring finger p...    48   4e-05
EF375726-1|ABN46990.1|  465|Homo sapiens parkin 2 protein.             47   7e-05
BC058929-1|AAH58929.1|  174|Homo sapiens ubiquitin-like 4B protein.    47   7e-05
BC022014-1|AAH22014.1|  387|Homo sapiens PARK2 protein protein.        47   7e-05
AL445215-2|CAH73682.1|  437|Homo sapiens Parkinson disease (auto...    47   7e-05
AL445215-1|CAH73681.1|  465|Homo sapiens Parkinson disease (auto...    47   7e-05
AL132982-2|CAI23602.1|  437|Homo sapiens Parkinson disease (auto...    47   7e-05
AL132982-1|CAI23601.1|  465|Homo sapiens Parkinson disease (auto...    47   7e-05
AL035697-3|CAI21386.1|  437|Homo sapiens Parkinson disease (auto...    47   7e-05
AL035697-2|CAI21385.1|  465|Homo sapiens Parkinson disease (auto...    47   7e-05
AL035697-1|CAI21384.1|  368|Homo sapiens Parkinson disease (auto...    47   7e-05
AK098556-1|BAC05331.1|  174|Homo sapiens protein ( Homo sapiens ...    47   7e-05
AB245403-1|BAF43729.1|  465|Homo sapiens parkin 2 protein.             47   7e-05
AB009973-1|BAA25751.1|  465|Homo sapiens Parkin protein.               47   7e-05
M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human HLA-B-ass...    46   1e-04
M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human HLA-B-ass...    46   1e-04
BC019910-1|AAH19910.1|  190|Homo sapiens UBTD2 protein protein.        46   1e-04
AF251700-1|AAL99389.1|  106|Homo sapiens ubiquitin-like protein ...    46   1e-04
BX511262-22|CAM45813.1|  158|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-21|CAM45812.1|  233|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-20|CAM45807.1|  262|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-19|CAM45805.1|  262|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-18|CAM45803.1|  259|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-17|CAM45811.1|  215|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-16|CAM45810.1|  206|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-15|CAM45809.1|  244|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-14|CAM45808.1|  244|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-13|CAM45806.1|  197|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-12|CAM45804.1|  258|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-11|CAM45802.1|  515|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-10|CAM45801.1|  743|Homo sapiens HLA-B associated trans...    45   2e-04
BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated transc...    45   2e-04
BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated transc...    45   2e-04
BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated transc...    45   2e-04
BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein.                45   2e-04
AL805934-24|CAO03665.1|  158|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-23|CAO03664.1|  233|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-22|CAO03663.1|  259|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-21|CAI18503.2|  206|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-20|CAI18505.2|  262|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-19|CAI18509.1|  262|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-18|CAO03662.1|  244|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-17|CAO03661.1|  215|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-16|CAO03660.1|  258|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-15|CAO03659.1|  244|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-14|CAO03658.1|  197|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-13|CAI18506.2|  515|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-12|CAI18508.2|  743|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated trans...    45   2e-04
AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated trans...    45   2e-04
AL670886-15|CAM25024.1|  158|Homo sapiens HLA-B associated trans...    45   2e-04
AL670886-14|CAM25023.1|  233|Homo sapiens HLA-B associated trans...    45   2e-04
AL670886-13|CAM25018.1|  258|Homo sapiens HLA-B associated trans...    45   2e-04
AL670886-12|CAM25021.1|  197|Homo sapiens HLA-B associated trans...    45   2e-04
AL670886-11|CAM25017.1|  206|Homo sapiens HLA-B associated trans...    45   2e-04
AL670886-10|CAM25015.1|  215|Homo sapiens HLA-B associated trans...    45   2e-04
AL670886-9|CAM25022.1|  262|Homo sapiens HLA-B associated transc...    45   2e-04
AL670886-8|CAM25019.1|  244|Homo sapiens HLA-B associated transc...    45   2e-04
AL670886-7|CAM25016.1|  244|Homo sapiens HLA-B associated transc...    45   2e-04
AL670886-6|CAI17786.1|  262|Homo sapiens HLA-B associated transc...    45   2e-04
AL670886-5|CAM25020.1|  259|Homo sapiens HLA-B associated transc...    45   2e-04
AL670886-4|CAI17787.2|  515|Homo sapiens HLA-B associated transc...    45   2e-04
AL670886-3|CAM25014.1|  743|Homo sapiens HLA-B associated transc...    45   2e-04
AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated transc...    45   2e-04
AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-15|CAO72082.1|  158|Homo sapiens HLA-B associated trans...    45   2e-04
AL662847-14|CAO72081.1|  233|Homo sapiens HLA-B associated trans...    45   2e-04
AL662847-13|CAO72079.1|  258|Homo sapiens HLA-B associated trans...    45   2e-04
AL662847-12|CAO72077.1|  197|Homo sapiens HLA-B associated trans...    45   2e-04
AL662847-11|CAO72076.1|  206|Homo sapiens HLA-B associated trans...    45   2e-04
AL662847-10|CAO72075.1|  215|Homo sapiens HLA-B associated trans...    45   2e-04
AL662847-9|CAO72080.1|  262|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-8|CAO72078.1|  244|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-7|CAO72073.1|  244|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-6|CAI17660.1|  262|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-5|CAO72074.1|  259|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-4|CAI17661.2|  515|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-3|CAO72072.1|  743|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated transc...    45   2e-04
AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated transc...    45   2e-04
AL662801-67|CAM25604.1|  158|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-66|CAM25603.1|  233|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-65|CAM25602.1|  244|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-64|CAM25601.1|  206|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-63|CAM25600.1|  215|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-62|CAM25599.1|  262|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-61|CAM25598.1|  262|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-60|CAM25597.1|  244|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-59|CAM25596.1|  197|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-58|CAM25595.1|  259|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-57|CAM25594.1|  258|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-56|CAI18318.2|  515|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-55|CAI18316.2|  743|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated trans...    45   2e-04
AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated trans...    45   2e-04
AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein.                45   2e-04
D21235-1|BAA04767.1|  363|Homo sapiens HHR23A protein protein.         45   3e-04
BC088364-1|AAH88364.1|  362|Homo sapiens RAD23 homolog A (S. cer...    45   3e-04
BC014026-1|AAH14026.1|  363|Homo sapiens RAD23 homolog A (S. cer...    45   3e-04
AF549209-1|AAN39383.1|  363|Homo sapiens RAD23 homolog A (S. cer...    45   3e-04
AD000092-7|AAB51177.1|  363|Homo sapiens human RAD23A homolog pr...    45   3e-04
AB209713-1|BAD92950.1|  379|Homo sapiens UV excision repair prot...    45   3e-04
X65923-1|CAA46716.1|  133|Homo sapiens fau protein.                    44   5e-04
X65921-1|CAA46714.1|  133|Homo sapiens fau 1 protein.                  44   5e-04
CR541974-1|CAG46772.1|  133|Homo sapiens FAU protein.                  44   5e-04
BC033877-1|AAH33877.1|  133|Homo sapiens Finkel-Biskis-Reilly mu...    44   5e-04
AY398663-1|AAQ87877.1|  133|Homo sapiens Finkel-Biskis-Reilly mu...    44   5e-04
AK026639-1|BAB15515.1|  133|Homo sapiens protein ( Homo sapiens ...    44   5e-04
M21786-1|AAA36128.1|  165|Homo sapiens protein ( Human interfero...    43   8e-04
M13755-1|AAA36038.1|  165|Homo sapiens protein ( Human interfero...    43   8e-04
BT007297-1|AAP35961.1|  165|Homo sapiens interferon, alpha-induc...    43   8e-04
BC009507-1|AAH09507.1|  165|Homo sapiens ISG15 ubiquitin-like mo...    43   8e-04
AY168648-1|AAN86983.1|  165|Homo sapiens ubiquitin-like protein ...    43   8e-04
AL645608-12|CAI15574.1|  165|Homo sapiens ISG15 ubiquitin-like m...    43   8e-04
X85237-1|CAA59494.1|  793|Homo sapiens human splicing factor pro...    43   0.001
CR456575-1|CAG30461.1|  793|Homo sapiens SF3A1 protein.                43   0.001
BC007684-1|AAH07684.1|  793|Homo sapiens splicing factor 3a, sub...    43   0.001
BC001976-1|AAH01976.1|  793|Homo sapiens splicing factor 3a, sub...    43   0.001
AC004997-4|AAC23435.1|  793|Homo sapiens spliceosome associated ...    43   0.001
AL445215-3|CAH73683.1|  316|Homo sapiens Parkinson disease (auto...    40   0.010
AL132982-3|CAI23603.1|  316|Homo sapiens Parkinson disease (auto...    40   0.010
AL118499-2|CAC00663.1|   18|Homo sapiens chromosome 20 open read...    40   0.010
AL035697-4|CAI21387.1|  316|Homo sapiens Parkinson disease (auto...    40   0.010
BC036743-1|AAH36743.1|  655|Homo sapiens ubiquilin 3 protein.          36   0.095
AF230481-1|AAF67143.1|  655|Homo sapiens ubiquilin 3 protein.          36   0.095
AF137396-1|AAG41675.1|  670|Homo sapiens ubiquilin 3 protein.          36   0.095
BC039294-1|AAH39294.1|  589|Homo sapiens ubiquilin 1 protein.          36   0.13 
BC010066-1|AAH10066.1|  561|Homo sapiens ubiquilin 1 protein.          36   0.13 
AL354920-5|CAI15101.1|  589|Homo sapiens ubiquilin 1 protein.          36   0.13 
AL354920-4|CAI15100.1|  561|Homo sapiens ubiquilin 1 protein.          36   0.13 
AK074535-1|BAC11045.1|  316|Homo sapiens protein ( Homo sapiens ...    36   0.13 
AF293384-1|AAG02473.1|  589|Homo sapiens PLIC-1 protein.               36   0.13 
AF176069-1|AAD49751.3|  589|Homo sapiens ubiquilin protein.            36   0.13 
BC063841-1|AAH63841.1|  601|Homo sapiens ubiquilin 4 protein.          35   0.22 
BC018403-1|AAH18403.1|  601|Homo sapiens ubiquilin 4 protein.          35   0.22 
AL355388-14|CAH72633.1|  601|Homo sapiens ubiquilin 4 protein.         35   0.22 
AL355388-13|CAH72634.1|  226|Homo sapiens ubiquilin 4 protein.         35   0.22 
AK023354-1|BAB14539.1|  314|Homo sapiens protein ( Homo sapiens ...    35   0.22 
AF188240-1|AAF80171.1|  601|Homo sapiens A1U protein.                  35   0.22 
AB209566-1|BAD92803.1|  600|Homo sapiens ataxin-1 ubiquitin-like...    35   0.22 
L42856-1|AAA75522.1|  118|Homo sapiens RNA polymerase II transcr...    31   2.7  
BC069237-1|AAH69237.1|  624|Homo sapiens UBQLN2 protein protein.       31   2.7  
BC065000-1|AAH65000.1|  118|Homo sapiens transcription elongatio...    31   2.7  
BC013306-1|AAH13306.1|  118|Homo sapiens transcription elongatio...    31   2.7  
AL354793-1|CAD13519.1|  624|Homo sapiens ubiquilin 2 protein.          31   2.7  
AF293385-1|AAG02474.1|  624|Homo sapiens PLIC-2 protein.               31   2.7  
AF189009-1|AAF17237.1|  624|Homo sapiens ubiquitin-like product ...    31   2.7  
AB035275-1|BAB20436.1|  589|Homo sapiens DA41 protein.                 31   2.7  
BC108694-1|AAI08695.1|  420|Homo sapiens IKBKB protein protein.        31   3.6  
AY663108-1|AAT65965.1|  756|Homo sapiens inhibitor of kappa ligh...    31   3.6  
AF080158-1|AAD08997.1|  756|Homo sapiens IkB kinase-b protein.         31   3.6  
AF031416-1|AAC64675.1|  756|Homo sapiens IkB kinase beta subunit...    31   3.6  
AF029684-1|AAC51860.1|  756|Homo sapiens IkB kinase-beta protein.      31   3.6  
AB209090-1|BAD92327.1|  483|Homo sapiens inhibitor of kappa ligh...    31   3.6  
AL442081-1|CAC09446.1|  588|Homo sapiens hypothetical protein pr...    31   4.7  
AL157766-3|CAI13923.2|  728|Homo sapiens spastic ataxia of Charl...    30   8.3  

>X63237-1|CAA44911.1|  156|Homo sapiens ubiquitin protein.
          Length = 156

 Score =  223 bits (545), Expect = 4e-58
 Identities = 113/156 (72%), Positives = 121/156 (77%), Gaps = 1/156 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K+Y+TP          KLAVL++YKVDENGKI RLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           C  ++CGAGVFMA   DRHYCGKC  T  F K +DK
Sbjct: 121 CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK 156


>S79522-1|AAB21188.1|  156|Homo sapiens ubiquitin carboxyl extension
           protein protein.
          Length = 156

 Score =  223 bits (545), Expect = 4e-58
 Identities = 113/156 (72%), Positives = 121/156 (77%), Gaps = 1/156 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K+Y+TP          KLAVL++YKVDENGKI RLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           C  ++CGAGVFMA   DRHYCGKC  T  F K +DK
Sbjct: 121 CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK 156


>BC066293-1|AAH66293.1|  156|Homo sapiens ribosomal protein S27a
           protein.
          Length = 156

 Score =  223 bits (545), Expect = 4e-58
 Identities = 113/156 (72%), Positives = 121/156 (77%), Gaps = 1/156 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K+Y+TP          KLAVL++YKVDENGKI RLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           C  ++CGAGVFMA   DRHYCGKC  T  F K +DK
Sbjct: 121 CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK 156


>BC001392-1|AAH01392.1|  156|Homo sapiens ribosomal protein S27a
           protein.
          Length = 156

 Score =  223 bits (545), Expect = 4e-58
 Identities = 113/156 (72%), Positives = 121/156 (77%), Gaps = 1/156 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K+Y+TP          KLAVL++YKVDENGKI RLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           C  ++CGAGVFMA   DRHYCGKC  T  F K +DK
Sbjct: 121 CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK 156


>BC053371-1|AAH53371.1|  156|Homo sapiens ribosomal protein S27a
           protein.
          Length = 156

 Score =  219 bits (536), Expect = 5e-57
 Identities = 112/156 (71%), Positives = 120/156 (76%), Gaps = 1/156 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            K+ +TP          KLAVL++YKVDENGKI RLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKSCTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           C  ++CGAGVFMA   DRHYCGKC  T  F K +DK
Sbjct: 121 CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK 156


>M10939-1|AAA36788.1|  152|Homo sapiens protein ( Human ubiquitin
           mRNA, 3' end. ).
          Length = 152

 Score =  215 bits (525), Expect = 1e-55
 Identities = 109/152 (71%), Positives = 117/152 (76%), Gaps = 1/152 (0%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYNIQKE
Sbjct: 1   VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 60

Query: 435 STLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGE 256
           STLHLV            K+Y+TP          KLAVL++YKVDENGKI RLRREC  +
Sbjct: 61  STLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSD 120

Query: 255 QCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           +CGAGVFMA   DRHYCGKC  T  F K +DK
Sbjct: 121 ECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK 152


>AB061854-1|BAB79488.1|  121|Homo sapiens ribosomal protein S27A
           protein.
          Length = 121

 Score =  154 bits (373), Expect = 3e-37
 Identities = 78/121 (64%), Positives = 86/121 (71%), Gaps = 1/121 (0%)
 Frame = -1

Query: 522 IPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXX 343
           IPP+QQRL FAGKQLEDGRTLSDYNIQKESTLHLV            K+Y+TP       
Sbjct: 1   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKR 60

Query: 342 XXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDD 166
              KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   DRHYCGKC  T  F K +D
Sbjct: 61  KKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED 120

Query: 165 K 163
           K
Sbjct: 121 K 121


>X56999-1|CAA40314.1|  128|Homo sapiens ubiquitin-52 amino acid
           fusion protein protein.
          Length = 128

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>X56998-1|CAA40313.1|  128|Homo sapiens ubiquitin-52 amino acid
           fusion protein  protein.
          Length = 128

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>X56997-1|CAA40312.1|  128|Homo sapiens ubiquitin-52 amino acid
           fusion protein protein.
          Length = 128

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>X04803-1|CAA28495.1|  229|Homo sapiens ubiquitin protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>M26880-1|AAA36789.1|  685|Homo sapiens protein ( Human ubiquitin
           mRNA, complete cds. ).
          Length = 685

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678


>M17597-1|AAA36787.1|  269|Homo sapiens protein ( Human
           poly-ubiquitin mRNA, complete cds. ).
          Length = 269

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 41  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 100

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 101 IQKESTLHLV 110



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 117 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 176

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 177 IQKESTLHLV 186



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 193 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 252

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 253 IQKESTLHLV 262



 Score = 70.5 bits (165), Expect = 5e-12
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = -1

Query: 519 PPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           PP+QQRL FAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 34


>D63791-1|BAA09860.1|  611|Homo sapiens polyubiquitin protein.
          Length = 611

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  138 bits (334), Expect = 2e-32
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLE EPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEGEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450


>DQ479851-1|ABE96835.1|  128|Homo sapiens ubiquitin A-52 residue
           ribosomal protein fusion product 1 protein.
          Length = 128

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>BT020104-1|AAV38907.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>BC101832-1|AAI01833.1|  128|Homo sapiens ubiquitin A-52 residue
           ribosomal protein fusion product 1 protein.
          Length = 128

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>BC101830-1|AAI01831.1|  128|Homo sapiens ubiquitin A-52 residue
           ribosomal protein fusion product 1 protein.
          Length = 128

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>BC080583-1|AAH80583.1|  698|Homo sapiens Unknown (protein for
           IMAGE:2822684) protein.
          Length = 698

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 14  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 73

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 74  IQKESTLHLV 83



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 90  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 149

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 150 IQKESTLHLV 159



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 166 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 225

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 226 IQKESTLHLV 235



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 242 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 301

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 302 IQKESTLHLV 311



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 318 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 377

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 378 IQKESTLHLV 387



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 394 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 453

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 454 IQKESTLHLV 463



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 470 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 529

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 530 IQKESTLHLV 539



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 546 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 605

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 606 IQKESTLHLV 615



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 622 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 681

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 682 IQKESTLHLV 691


>BC046123-1|AAH46123.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>BC039193-1|AAH39193.1|  685|Homo sapiens ubiquitin C protein.
          Length = 685

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678


>BC038999-1|AAH38999.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>BC031027-1|AAH31027.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>BC026301-1|AAH26301.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>BC015127-1|AAH15127.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>BC014880-1|AAH14880.1|  305|Homo sapiens UBC protein protein.
          Length = 305

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298


>BC009301-1|AAH09301.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>BC008955-1|AAH08955.2|  546|Homo sapiens UBC protein protein.
          Length = 546

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 14  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 73

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 74  IQKESTLHLV 83



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 90  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 149

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 150 IQKESTLHLV 159



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 166 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 225

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 226 IQKESTLHLV 235



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 242 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 301

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 302 IQKESTLHLV 311



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 318 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 377

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 378 IQKESTLHLV 387



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 394 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 453

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 454 IQKESTLHLV 463



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 470 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 529

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 530 IQKESTLHLV 539


>BC000379-1|AAH00379.1|  229|Homo sapiens ubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>AY819759-1|AAV68344.1|  229|Homo sapiens ubiquitin C splice variant
           protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>AY732488-1|AAV33127.1|  153|Homo sapiens ubiquitin C splice variant
           protein.
          Length = 153

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  138 bits (334), Expect = 2e-32
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLS YN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSGYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146


>AL117514-1|CAB55973.1|  239|Homo sapiens hypothetical protein
           protein.
          Length = 239

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 11  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 70

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 71  IQKESTLHLV 80



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 87  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 146

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 147 IQKESTLHLV 156



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 163 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 222

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 223 IQKESTLHLV 232


>AK056939-1|BAB71316.1|  388|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32377 fis, clone SKMUS1000014, highly similar to
           Polyubiquitin 9. ).
          Length = 388

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 123 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 182

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 183 IQKESTLHLV 192



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 199 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 258

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 259 IQKESTLHLV 268



 Score =  129 bits (312), Expect = 7e-30
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKE 436
           IQKE
Sbjct: 61  IQKE 64



 Score =  116 bits (280), Expect = 6e-26
 Identities = 56/58 (96%), Positives = 57/58 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSD
Sbjct: 275 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 332



 Score =  109 bits (263), Expect = 6e-24
 Identities = 53/64 (82%), Positives = 59/64 (92%), Gaps = 3/64 (4%)
 Frame = -1

Query: 600 GKTIT---LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKEST 430
           G+T++   ++ EPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYNIQKEST
Sbjct: 53  GRTLSDYNIQKEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST 112

Query: 429 LHLV 418
           LHLV
Sbjct: 113 LHLV 116



 Score =  103 bits (248), Expect = 4e-22
 Identities = 49/51 (96%), Positives = 50/51 (98%)
 Frame = -1

Query: 570 SDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           SDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 331 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 381


>AF348700-1|AAK31162.1|  141|Homo sapiens ubiquitin A-52 residue
           ribosomal protein fusion product 1 protein.
          Length = 141

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 14  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 73

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 74  IQKESTLHLV 83


>AC005253-2|AAC25582.1|  128|Homo sapiens ubiquitin-52 amino acid
           fusion protein protein.
          Length = 128

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>AB209782-1|BAD93019.1| 1309|Homo sapiens ubiquitin C variant
           protein.
          Length = 1309

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 17  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 76

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 77  IQKESTLHLV 86



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 93  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 152

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 153 IQKESTLHLV 162



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 169 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 228

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 229 IQKESTLHLV 238



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 245 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 304

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 305 IQKESTLHLV 314



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 321 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 380

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 381 IQKESTLHLV 390



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 397 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 456

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 457 IQKESTLHLV 466



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 473 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 532

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 533 IQKESTLHLV 542



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 549 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 608

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 609 IQKESTLHLV 618



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 625 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 684

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 685 IQKESTLHLV 694



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 701 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 760

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 761 IQKESTLHLV 770



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 777 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 836

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 837 IQKESTLHLV 846



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 853  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 912

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 913  IQKESTLHLV 922



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 929  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 988

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 989  IQKESTLHLV 998



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1005 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 1064

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 1065 IQKESTLHLV 1074



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1081 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 1140

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 1141 IQKESTLHLV 1150



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1157 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 1216

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 1217 IQKESTLHLV 1226



 Score =  139 bits (336), Expect = 9e-33
 Identities = 67/70 (95%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLE+GRTLSDYN
Sbjct: 1233 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLENGRTLSDYN 1292

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 1293 IQKESTLHLV 1302


>AB089617-1|BAC56955.1|  229|Homo sapiens polyubiquitin B protein.
          Length = 229

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>AB089613-1|BAC56951.1|  685|Homo sapiens polyubiquitin C protein.
          Length = 685

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678


>AB009010-1|BAA23632.1|  685|Homo sapiens polyubiquitin UbC protein.
          Length = 685

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678


>AB003730-1|BAA23486.1|  609|Homo sapiens polyubiquitin protein.
          Length = 609

 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 2e-33
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  139 bits (336), Expect = 9e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTIT EVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITXEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526


>AK127995-1|BAC87221.1|  186|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46113 fis, clone TESTI2036285, highly  similar
           to Rattus norvegicus ubiquitin C (Ubc). ).
          Length = 186

 Score =  139 bits (337), Expect = 7e-33
 Identities = 67/70 (95%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGR+LSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRSLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  123 bits (296), Expect = 6e-28
 Identities = 61/70 (87%), Positives = 64/70 (91%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M+IFVKTLTGK ITLEVEPS TIENVKAKIQDKEG P +QQRL FAGKQ EDGR+LSDYN
Sbjct: 1   MRIFVKTLTGKIITLEVEPSATIENVKAKIQDKEGNPCDQQRLIFAGKQREDGRSLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score = 31.5 bits (68), Expect = 2.7
 Identities = 14/14 (100%), Positives = 14/14 (100%)
 Frame = -1

Query: 627 MQIFVKTLTGKTIT 586
           MQIFVKTLTGKTIT
Sbjct: 153 MQIFVKTLTGKTIT 166


>BC042362-1|AAH42362.1|   95|Homo sapiens RPS27A protein protein.
          Length = 95

 Score =  127 bits (307), Expect = 3e-29
 Identities = 61/63 (96%), Positives = 62/63 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQK 439
           IQK
Sbjct: 61  IQK 63


>D23662-1|BAA04889.1|   81|Homo sapiens ubiquitin-like protein
           protein.
          Length = 81

 Score = 88.2 bits (209), Expect = 2e-17
 Identities = 38/70 (54%), Positives = 53/70 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D +E +K ++++KEGIPP QQRL ++GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK 60

Query: 447 IQKESTLHLV 418
           I   S LHLV
Sbjct: 61  ILGGSVLHLV 70


>BC104664-1|AAI04665.1|   81|Homo sapiens neural precursor cell
           expressed, developmentally down-regulated 8 protein.
          Length = 81

 Score = 88.2 bits (209), Expect = 2e-17
 Identities = 38/70 (54%), Positives = 53/70 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D +E +K ++++KEGIPP QQRL ++GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK 60

Query: 447 IQKESTLHLV 418
           I   S LHLV
Sbjct: 61  ILGGSVLHLV 70


>BC104201-1|AAI04202.1|   81|Homo sapiens neural precursor cell
           expressed, developmentally down-regulated 8 protein.
          Length = 81

 Score = 88.2 bits (209), Expect = 2e-17
 Identities = 38/70 (54%), Positives = 53/70 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D +E +K ++++KEGIPP QQRL ++GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK 60

Query: 447 IQKESTLHLV 418
           I   S LHLV
Sbjct: 61  ILGGSVLHLV 70


>BC104200-1|AAI04201.1|   81|Homo sapiens neural precursor cell
           expressed, developmentally down-regulated 8 protein.
          Length = 81

 Score = 88.2 bits (209), Expect = 2e-17
 Identities = 38/70 (54%), Positives = 53/70 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D +E +K ++++KEGIPP QQRL ++GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK 60

Query: 447 IQKESTLHLV 418
           I   S LHLV
Sbjct: 61  ILGGSVLHLV 70


>CR407662-1|CAG28590.1|   81|Homo sapiens NEDD8 protein.
          Length = 81

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 38/70 (54%), Positives = 53/70 (75%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D +E +K ++++KEGIPP QQRL ++GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEVDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK 60

Query: 447 IQKESTLHLV 418
           I   S LHLV
Sbjct: 61  ILGGSVLHLV 70


>AB007163-1|BAA25826.1|   51|Homo sapiens ribosomal protein S27a
           protein.
          Length = 51

 Score = 83.0 bits (196), Expect = 8e-16
 Identities = 35/45 (77%), Positives = 39/45 (86%)
 Frame = -1

Query: 330 LAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKC 196
           LAVL++YKVDENGKI RLRREC  ++CGAGVFMA   DRHYCGKC
Sbjct: 3   LAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKC 47


>AB062071-1|BAB79490.1|   34|Homo sapiens ribosomal protein S27a
           protein.
          Length = 34

 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 526
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE 34


>Y00361-1|CAA68439.1|   89|Homo sapiens ubiquitin precursor protein.
          Length = 89

 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 30/31 (96%), Positives = 30/31 (96%)
 Frame = -1

Query: 510 QQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           QQRL FAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1   QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 31


>BC045587-1|AAH45587.2|  727|Homo sapiens ANUBL1 protein protein.
          Length = 727

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++F++TLTG    L V P +T+ +VKAKI+  EGIP  +Q L +   +LE+   L+DYN
Sbjct: 28  MELFIETLTGTCFELRVSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYN 87

Query: 447 IQKESTLHLV 418
           I +  TL LV
Sbjct: 88  ISEGCTLKLV 97


>AL445201-5|CAH72970.1|  115|Homo sapiens AN1, ubiquitin-like,
           homolog (Xenopus laevis) protein.
          Length = 115

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++F++TLTG    L V P +T+ +VKAKI+  EGIP  +Q L +   +LE+   L+DYN
Sbjct: 28  MELFIETLTGTCFELRVSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYN 87

Query: 447 IQKESTLHLV 418
           I +  TL LV
Sbjct: 88  ISEGCTLKLV 97


>AL445201-4|CAH72968.1|  224|Homo sapiens AN1, ubiquitin-like,
           homolog (Xenopus laevis) protein.
          Length = 224

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++F++TLTG    L V P +T+ +VKAKI+  EGIP  +Q L +   +LE+   L+DYN
Sbjct: 28  MELFIETLTGTCFELRVSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYN 87

Query: 447 IQKESTLHLV 418
           I +  TL LV
Sbjct: 88  ISEGCTLKLV 97


>AL445201-3|CAH72967.1|  727|Homo sapiens AN1, ubiquitin-like,
           homolog (Xenopus laevis) protein.
          Length = 727

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++F++TLTG    L V P +T+ +VKAKI+  EGIP  +Q L +   +LE+   L+DYN
Sbjct: 28  MELFIETLTGTCFELRVSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYN 87

Query: 447 IQKESTLHLV 418
           I +  TL LV
Sbjct: 88  ISEGCTLKLV 97


>AF311324-1|AAG33850.1|  727|Homo sapiens ubiquitin-like fusion
           protein protein.
          Length = 727

 Score = 64.1 bits (149), Expect = 4e-10
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++F++TLTG    L V P +T+ +VKAKI+  EGIP  +Q L +   +LE+   L+DYN
Sbjct: 28  MELFIETLTGTCFELRVSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYN 87

Query: 447 IQKESTLHLV 418
           I +  TL LV
Sbjct: 88  ISEGCTLKLV 97


>L44140-7|AAA92650.1|  157|Homo sapiens protein ( , complete cds's.
           ).).
          Length = 157

 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VK L G+  +L+V   + +  +K  + +K  +P  QQRL F GK L DG+ LSDY+
Sbjct: 1   MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS 60

Query: 447 IQKESTLHLV 418
           I   S L+LV
Sbjct: 61  IGPNSKLNLV 70


>J03589-1|AAA36790.1|  157|Homo sapiens protein ( Human
           ubiquitin-like protein (GdX) gene, complete cds. ).
          Length = 157

 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VK L G+  +L+V   + +  +K  + +K  +P  QQRL F GK L DG+ LSDY+
Sbjct: 1   MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS 60

Query: 447 IQKESTLHLV 418
           I   S L+LV
Sbjct: 61  IGPNSKLNLV 70


>BX664739-2|CAI43235.1|  157|Homo sapiens ubiquitin-like 4 protein.
          Length = 157

 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VK L G+  +L+V   + +  +K  + +K  +P  QQRL F GK L DG+ LSDY+
Sbjct: 1   MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS 60

Query: 447 IQKESTLHLV 418
           I   S L+LV
Sbjct: 61  IGPNSKLNLV 70


>BX664739-1|CAI43234.1|  180|Homo sapiens ubiquitin-like 4 protein.
          Length = 180

 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VK L G+  +L+V   + +  +K  + +K  +P  QQRL F GK L DG+ LSDY+
Sbjct: 1   MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS 60

Query: 447 IQKESTLHLV 418
           I   S L+LV
Sbjct: 61  IGPNSKLNLV 70


>BC053589-1|AAH53589.1|  157|Homo sapiens ubiquitin-like 4A protein.
          Length = 157

 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VK L G+  +L+V   + +  +K  + +K  +P  QQRL F GK L DG+ LSDY+
Sbjct: 1   MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS 60

Query: 447 IQKESTLHLV 418
           I   S L+LV
Sbjct: 61  IGPNSKLNLV 70


>BC043346-1|AAH43346.1|  157|Homo sapiens ubiquitin-like 4A protein.
          Length = 157

 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 30/70 (42%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+ VK L G+  +L+V   + +  +K  + +K  +P  QQRL F GK L DG+ LSDY+
Sbjct: 1   MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYS 60

Query: 447 IQKESTLHLV 418
           I   S L+LV
Sbjct: 61  IGPNSKLNLV 70


>AF063611-1|AAD28541.1|  513|Homo sapiens 2'-5'oligoadenylate
           synthetase-related protein p56 protein.
          Length = 513

 Score = 55.6 bits (128), Expect = 1e-07
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++Q+FVK   G T    + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y
Sbjct: 432 EIQVFVKNPDGGTYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIY 491

Query: 450 NIQKESTLHL 421
            IQ   TL L
Sbjct: 492 GIQDSDTLIL 501


>BC117410-1|AAI17411.1|  514|Homo sapiens 2'-5'-oligoadenylate
           synthetase-like protein.
          Length = 514

 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 26/70 (37%), Positives = 41/70 (58%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++Q+FVK   G +    + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y
Sbjct: 433 EIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIY 492

Query: 450 NIQKESTLHL 421
            IQ   TL L
Sbjct: 493 GIQDSDTLIL 502


>BC117408-1|AAI17409.1|  514|Homo sapiens 2'-5'-oligoadenylate
           synthetase-like protein.
          Length = 514

 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 26/70 (37%), Positives = 41/70 (58%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++Q+FVK   G +    + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y
Sbjct: 433 EIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIY 492

Query: 450 NIQKESTLHL 421
            IQ   TL L
Sbjct: 493 GIQDSDTLIL 502


>AJ225089-1|CAA12396.1|  514|Homo sapiens 2'-5' oligoadenylate
           synthetase (p59OAS) protein.
          Length = 514

 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 26/70 (37%), Positives = 41/70 (58%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++Q+FVK   G +    + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y
Sbjct: 433 EIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIY 492

Query: 450 NIQKESTLHL 421
            IQ   TL L
Sbjct: 493 GIQDSDTLIL 502


>EF560733-1|ABQ59043.1|  793|Homo sapiens UHRF1 protein protein.
          Length = 793

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G+ T T++ +     +E ++ KIQ+   + P  QRL + GKQ+EDG TL D
Sbjct: 1   MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y ++   T+ L+
Sbjct: 61  YEVRLNDTIQLL 72


>BC113875-1|AAI13876.2|  806|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 1 protein.
          Length = 806

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G+ T T++ +     +E ++ KIQ+   + P  QRL + GKQ+EDG TL D
Sbjct: 14  MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD 73

Query: 453 YNIQKESTLHLV 418
           Y ++   T+ L+
Sbjct: 74  YEVRLNDTIQLL 85


>AY787925-1|AAV40831.1|  793|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 1 protein.
          Length = 793

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G+ T T++ +     +E ++ KIQ+   + P  QRL + GKQ+EDG TL D
Sbjct: 1   MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y ++   T+ L+
Sbjct: 61  YEVRLNDTIQLL 72


>AF274048-1|AAK55744.1|  793|Homo sapiens nuclear zinc finger
           protein Np95 protein.
          Length = 793

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G+ T T++ +     +E ++ KIQ+   + P  QRL + GKQ+EDG TL D
Sbjct: 1   MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y ++   T+ L+
Sbjct: 61  YEVRLNDTIQLL 72


>AF129507-1|AAF28469.1|  793|Homo sapiens transcription factor
           ICBP90 protein.
          Length = 793

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G+ T T++ +     +E ++ KIQ+   + P  QRL + GKQ+EDG TL D
Sbjct: 1   MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y ++   T+ L+
Sbjct: 61  YEVRLNDTIQLL 72


>AB177624-1|BAF36720.1|  793|Homo sapiens hNP95 protein.
          Length = 793

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G+ T T++ +     +E ++ KIQ+   + P  QRL + GKQ+EDG TL D
Sbjct: 1   MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y ++   T+ L+
Sbjct: 61  YEVRLNDTIQLL 72


>AB177623-1|BAF36719.1|  793|Homo sapiens hNP95 protein.
          Length = 793

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGK-TITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G+ T T++ +     +E ++ KIQ+   + P  QRL + GKQ+EDG TL D
Sbjct: 1   MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y ++   T+ L+
Sbjct: 61  YEVRLNDTIQLL 72


>D21090-1|BAA04652.1|  409|Homo sapiens XP-C repair complementing
           protein (p58/HHR23B) protein.
          Length = 409

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL  +T  ++++P +T++ +K KI+ ++G    P   Q+L +AGK L D   L 
Sbjct: 1   MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>BC020973-1|AAH20973.1|  409|Homo sapiens RAD23B protein protein.
          Length = 409

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL  +T  ++++P +T++ +K KI+ ++G    P   Q+L +AGK L D   L 
Sbjct: 1   MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>AY165178-1|AAN47194.1|  409|Homo sapiens RAD23 homolog B (S.
           cerevisiae) protein.
          Length = 409

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL  +T  ++++P +T++ +K KI+ ++G    P   Q+L +AGK L D   L 
Sbjct: 1   MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>AL137852-2|CAD13275.1|  409|Homo sapiens RAD23 homolog B (S.
           cerevisiae) protein.
          Length = 409

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL  +T  ++++P +T++ +K KI+ ++G    P   Q+L +AGK L D   L 
Sbjct: 1   MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>AL137852-1|CAH70394.1|  146|Homo sapiens RAD23 homolog B (S.
           cerevisiae) protein.
          Length = 146

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL  +T  ++++P +T++ +K KI+ ++G    P   Q+L +AGK L D   L 
Sbjct: 1   MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>AK223479-1|BAD97199.1|  409|Homo sapiens UV excision repair protein
           RAD23 homolog B variant protein.
          Length = 409

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 23/68 (33%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLS 457
           MQ+ +KTL  +T  ++++P +T++ +K KI+ ++G    P   Q+L +AGK L D   L 
Sbjct: 1   MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK 60

Query: 456 DYNIQKES 433
           +Y I +++
Sbjct: 61  EYKIDEKN 68


>Y12653-1|CAA73200.1|  165|Homo sapiens diubiquitin protein.
          Length = 165

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L+V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 104 LQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>BX000688-3|CAI18599.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L+V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 104 LQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>BC012472-1|AAH12472.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L+V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 104 LQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>AL662826-3|CAI17384.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L+V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 104 LQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>AL645936-2|CAI18010.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L+V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 104 LQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>AL031983-3|CAA21458.1|  165|Homo sapiens ubiquitin D protein.
          Length = 165

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L+V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 104 LQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>AF123050-1|AAD52982.1|  165|Homo sapiens ubiquitin-like protein
           FAT10 protein.
          Length = 165

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = -1

Query: 585 LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHL 421
           L+V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 104 LQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>BC007331-1|AAH07331.1|  227|Homo sapiens ubiquitin domain
           containing 1 protein.
          Length = 227

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 24/73 (32%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R +  + V+  TGK + L     DT+  +K ++  +EGI P+ QR  F+GK L D   L 
Sbjct: 146 RREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQ 205

Query: 456 DYNIQKESTLHLV 418
           +  IQK+  + ++
Sbjct: 206 ETKIQKDFVIQVI 218


>AL359388-3|CAI14191.1|  227|Homo sapiens ubiquitin domain
           containing 1 protein.
          Length = 227

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 24/73 (32%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R +  + V+  TGK + L     DT+  +K ++  +EGI P+ QR  F+GK L D   L 
Sbjct: 146 RREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQ 205

Query: 456 DYNIQKESTLHLV 418
           +  IQK+  + ++
Sbjct: 206 ETKIQKDFVIQVI 218


>AK021869-1|BAB13921.1|  227|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11807 fis, clone HEMBA1006284. ).
          Length = 227

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 24/73 (32%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R +  + V+  TGK + L     DT+  +K ++  +EGI P+ QR  F+GK L D   L 
Sbjct: 146 RREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQ 205

Query: 456 DYNIQKESTLHLV 418
           +  IQK+  + ++
Sbjct: 206 ETKIQKDFVIQVI 218


>AK222597-1|BAD96317.1|  227|Homo sapiens ubiquitin domain
           containing 1 variant protein.
          Length = 227

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 24/73 (32%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R +  + V+  TGK + L     DT+  +K ++  +EGI P+ QR  F+GK L D   L 
Sbjct: 146 RREFPLKVRLSTGKDVRLSASLPDTVGLLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQ 205

Query: 456 DYNIQKESTLHLV 418
           +  IQK+  + ++
Sbjct: 206 ETKIQKDFVIQVI 218


>BC028397-1|AAH28397.1|  503|Homo sapiens UHRF2 protein protein.
          Length = 503

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTG-KTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G KT T+E V    TIE ++ ++     + P  QRL + GKQLE+G TL D
Sbjct: 1   MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y++     + L+
Sbjct: 61  YDVGLNDIIQLL 72


>AL353718-4|CAH74119.1|  802|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 2 protein.
          Length = 802

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTG-KTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G KT T+E V    TIE ++ ++     + P  QRL + GKQLE+G TL D
Sbjct: 1   MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y++     + L+
Sbjct: 61  YDVGLNDIIQLL 72


>AL133480-6|CAI13294.1|  136|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 2 protein.
          Length = 136

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTG-KTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G KT T+E V    TIE ++ ++     + P  QRL + GKQLE+G TL D
Sbjct: 1   MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y++     + L+
Sbjct: 61  YDVGLNDIIQLL 72


>AL133480-5|CAI13293.1|  802|Homo sapiens ubiquitin-like, containing
           PHD and RING finger domains, 2 protein.
          Length = 802

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTG-KTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G KT T+E V    TIE ++ ++     + P  QRL + GKQLE+G TL D
Sbjct: 1   MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y++     + L+
Sbjct: 61  YDVGLNDIIQLL 72


>AF274049-1|AAM33799.1|  802|Homo sapiens nuclear zinc finger
           protein Np97 protein.
          Length = 802

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTG-KTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G KT T+E V    TIE ++ ++     + P  QRL + GKQLE+G TL D
Sbjct: 1   MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y++     + L+
Sbjct: 61  YDVGLNDIIQLL 72


>AB071698-1|BAB68317.1|  802|Homo sapiens Np95-like ring finger
           protein protein.
          Length = 802

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTG-KTITLE-VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M I V+T+ G KT T+E V    TIE ++ ++     + P  QRL + GKQLE+G TL D
Sbjct: 1   MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFD 60

Query: 453 YNIQKESTLHLV 418
           Y++     + L+
Sbjct: 61  YDVGLNDIIQLL 72


>EF375726-1|ABN46990.1|  465|Homo sapiens parkin 2 protein.
          Length = 465

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>BC058929-1|AAH58929.1|  174|Homo sapiens ubiquitin-like 4B protein.
          Length = 174

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M + VK L G+  +L+V   +++  +K  +  +  +P  QQ L F G+ LED + LSDY 
Sbjct: 1   MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYC 60

Query: 447 IQKESTLHLV 418
           I   ++++++
Sbjct: 61  IGPNASINVI 70


>BC022014-1|AAH22014.1|  387|Homo sapiens PARK2 protein protein.
          Length = 387

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AL445215-2|CAH73682.1|  437|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)eta protein.
          Length = 437

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AL445215-1|CAH73681.1|  465|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)ier family 9
           (sodium\/hydrogen protein.
          Length = 465

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AL132982-2|CAI23602.1|  437|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)rate protein.
          Length = 437

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AL132982-1|CAI23601.1|  465|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)lo2, SUR4/Elo3,
           yeast)-like 4 protein.
          Length = 465

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AL035697-3|CAI21386.1|  437|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)r 1 protein.
          Length = 437

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AL035697-2|CAI21385.1|  465|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)adenine nucleotide
           translocato protein.
          Length = 465

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AL035697-1|CAI21384.1|  368|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)family, member 1 protein.
          Length = 368

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AK098556-1|BAC05331.1|  174|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25690 fis, clone TST04424. ).
          Length = 174

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M + VK L G+  +L+V   +++  +K  +  +  +P  QQ L F G+ LED + LSDY 
Sbjct: 1   MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYC 60

Query: 447 IQKESTLHLV 418
           I   ++++++
Sbjct: 61  IGPNASINVI 70


>AB245403-1|BAF43729.1|  465|Homo sapiens parkin 2 protein.
          Length = 465

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>AB009973-1|BAA25751.1|  465|Homo sapiens Parkin protein.
          Length = 465

 Score = 46.8 bits (106), Expect = 7e-05
 Identities = 20/70 (28%), Positives = 43/70 (61%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ + +
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD 60

Query: 447 IQKESTLHLV 418
           + ++S +H+V
Sbjct: 61  LDQQSIVHIV 70


>M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human
           HLA-B-associated transcript 3 (BAT3) gene, 3' end. ).
          Length = 1132

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/70 (32%), Positives = 39/70 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I+    IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIRASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human
           HLA-B-associated transcript 3 (BAT3) mRNA, complete cds.
           ).
          Length = 1132

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/70 (32%), Positives = 39/70 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I+    IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIRASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BC019910-1|AAH19910.1|  190|Homo sapiens UBTD2 protein protein.
          Length = 190

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q+ ++  TGK + L V  +DT+ ++K ++   EG+ P  QR  F+G+ L D     +  I
Sbjct: 109 QLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKI 168

Query: 444 QKESTLHLV 418
            K+  + ++
Sbjct: 169 PKDYVVQVI 177


>AF251700-1|AAL99389.1|  106|Homo sapiens ubiquitin-like protein
           SB72 protein.
          Length = 106

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = -1

Query: 624 QIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNI 445
           Q+ ++  TGK + L V  +DT+ ++K ++   EG+ P  QR  F+G+ L D     +  I
Sbjct: 25  QLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKI 84

Query: 444 QKESTLHLV 418
            K+  + ++
Sbjct: 85  PKDYVVQVI 93


>BX511262-22|CAM45813.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-21|CAM45812.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-20|CAM45807.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-19|CAM45805.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-18|CAM45803.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-17|CAM45811.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-16|CAM45810.1|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-15|CAM45809.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-14|CAM45808.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-13|CAM45806.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-12|CAM45804.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-11|CAM45802.1|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-10|CAM45801.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein.
          Length = 1126

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-24|CAO03665.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-23|CAO03664.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-22|CAO03663.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-21|CAI18503.2|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-20|CAI18505.2|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-19|CAI18509.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-18|CAO03662.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-17|CAO03661.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-16|CAO03660.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-15|CAO03659.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-14|CAO03658.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-13|CAI18506.2|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-12|CAI18508.2|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-15|CAM25024.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-14|CAM25023.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-13|CAM25018.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-12|CAM25021.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-11|CAM25017.1|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-10|CAM25015.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-9|CAM25022.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-8|CAM25019.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-7|CAM25016.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-6|CAI17786.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-5|CAM25020.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-4|CAI17787.2|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-3|CAM25014.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-15|CAO72082.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-14|CAO72081.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-13|CAO72079.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-12|CAO72077.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-11|CAO72076.1|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-10|CAO72075.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-9|CAO72080.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-8|CAO72078.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-7|CAO72073.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-6|CAI17660.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-5|CAO72074.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-4|CAI17661.2|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-3|CAO72072.1|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-67|CAM25604.1|  158|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 158

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-66|CAM25603.1|  233|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 233

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-65|CAM25602.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-64|CAM25601.1|  206|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 206

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-63|CAM25600.1|  215|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 215

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-62|CAM25599.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-61|CAM25598.1|  262|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 262

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-60|CAM25597.1|  244|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 244

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-59|CAM25596.1|  197|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 197

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-58|CAM25595.1|  259|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 259

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-57|CAM25594.1|  258|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 258

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-56|CAI18318.2|  515|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 515

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-55|CAI18316.2|  743|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 743

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1132

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated
           transcript 3 protein.
          Length = 1126

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 17  LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 76

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 77  VGGK-VIHLV 85


>AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein.
          Length = 1229

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKTL  +T T  V     ++  K  I     IP  +QRL + G+ L+D + L +YN
Sbjct: 120 LEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYN 179

Query: 447 IQKESTLHLV 418
           +  +  +HLV
Sbjct: 180 VGGK-VIHLV 188


>D21235-1|BAA04767.1|  363|Homo sapiens HHR23A protein protein.
          Length = 363

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLSDY 451
           I +KTL  +T  + +EP +T++ +K KI+ ++G    P   Q+L +AGK L D   + DY
Sbjct: 5   ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDY 64

Query: 450 NIQKES 433
            I +++
Sbjct: 65  RIDEKN 70


>BC088364-1|AAH88364.1|  362|Homo sapiens RAD23 homolog A (S.
           cerevisiae) protein.
          Length = 362

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLSDY 451
           I +KTL  +T  + +EP +T++ +K KI+ ++G    P   Q+L +AGK L D   + DY
Sbjct: 5   ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDY 64

Query: 450 NIQKES 433
            I +++
Sbjct: 65  RIDEKN 70


>BC014026-1|AAH14026.1|  363|Homo sapiens RAD23 homolog A (S.
           cerevisiae) protein.
          Length = 363

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLSDY 451
           I +KTL  +T  + +EP +T++ +K KI+ ++G    P   Q+L +AGK L D   + DY
Sbjct: 5   ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDY 64

Query: 450 NIQKES 433
            I +++
Sbjct: 65  RIDEKN 70


>AF549209-1|AAN39383.1|  363|Homo sapiens RAD23 homolog A (S.
           cerevisiae) protein.
          Length = 363

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLSDY 451
           I +KTL  +T  + +EP +T++ +K KI+ ++G    P   Q+L +AGK L D   + DY
Sbjct: 5   ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDY 64

Query: 450 NIQKES 433
            I +++
Sbjct: 65  RIDEKN 70


>AD000092-7|AAB51177.1|  363|Homo sapiens human RAD23A homolog
           protein.
          Length = 363

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLSDY 451
           I +KTL  +T  + +EP +T++ +K KI+ ++G    P   Q+L +AGK L D   + DY
Sbjct: 5   ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDY 64

Query: 450 NIQKES 433
            I +++
Sbjct: 65  RIDEKN 70


>AB209713-1|BAD92950.1|  379|Homo sapiens UV excision repair protein
           RAD23 homolog A variant protein.
          Length = 379

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 3/66 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPNQQRLXFAGKQLEDGRTLSDY 451
           I +KTL  +T  + +EP +T++ +K KI+ ++G    P   Q+L +AGK L D   + DY
Sbjct: 22  ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDY 81

Query: 450 NIQKES 433
            I +++
Sbjct: 82  RIDEKN 87


>X65923-1|CAA46716.1|  133|Homo sapiens fau protein.
          Length = 133

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+FV+    +  T EV   +T+  +KA +   EGI P  Q +  AG  LED  TL    
Sbjct: 1   MQLFVRAQ--ELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCG 58

Query: 447 IQKESTLHL 421
           ++  +TL +
Sbjct: 59  VEALTTLEV 67


>X65921-1|CAA46714.1|  133|Homo sapiens fau 1 protein.
          Length = 133

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+FV+    +  T EV   +T+  +KA +   EGI P  Q +  AG  LED  TL    
Sbjct: 1   MQLFVRAQ--ELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCG 58

Query: 447 IQKESTLHL 421
           ++  +TL +
Sbjct: 59  VEALTTLEV 67


>CR541974-1|CAG46772.1|  133|Homo sapiens FAU protein.
          Length = 133

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+FV+    +  T EV   +T+  +KA +   EGI P  Q +  AG  LED  TL    
Sbjct: 1   MQLFVRAQ--ELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCG 58

Query: 447 IQKESTLHL 421
           ++  +TL +
Sbjct: 59  VEALTTLEV 67


>BC033877-1|AAH33877.1|  133|Homo sapiens Finkel-Biskis-Reilly
           murine sarcoma virus (FBR-MuSV) ubiquitously expressed
           protein.
          Length = 133

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+FV+    +  T EV   +T+  +KA +   EGI P  Q +  AG  LED  TL    
Sbjct: 1   MQLFVRAQ--ELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCG 58

Query: 447 IQKESTLHL 421
           ++  +TL +
Sbjct: 59  VEALTTLEV 67


>AY398663-1|AAQ87877.1|  133|Homo sapiens Finkel-Biskis-Reilly
           murine sarcoma virus (FBR-MuSV) ubiquitously expressed
           (fo protein.
          Length = 133

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+FV+    +  T EV   +T+  +KA +   EGI P  Q +  AG  LED  TL    
Sbjct: 1   MQLFVRAQ--ELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCG 58

Query: 447 IQKESTLHL 421
           ++  +TL +
Sbjct: 59  VEALTTLEV 67


>AK026639-1|BAB15515.1|  133|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22986 fis, clone KAT11742. ).
          Length = 133

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQ+FV+    +  T EV   +T+  +KA +   EGI P  Q +  AG  LED  TL    
Sbjct: 1   MQLFVRAQ--ELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCG 58

Query: 447 IQKESTLHL 421
           ++  +TL +
Sbjct: 59  VEALTTLEV 67


>M21786-1|AAA36128.1|  165|Homo sapiens protein ( Human
           interferon-induced 15-Kd protein (ISG) gene, exon 2. ).
          Length = 165

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V+   G++ T EV  + T+ ++K ++   EG+  +   L F GK LED   L +Y 
Sbjct: 82  LSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYG 141

Query: 447 IQKESTLHL 421
           ++  ST+ +
Sbjct: 142 LKPLSTVFM 150


>M13755-1|AAA36038.1|  165|Homo sapiens protein ( Human
           interferon-induced 17-kDa/15-kDa protein mRNA, complete
           cds. ).
          Length = 165

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V+   G++ T EV  + T+ ++K ++   EG+  +   L F GK LED   L +Y 
Sbjct: 82  LSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYG 141

Query: 447 IQKESTLHL 421
           ++  ST+ +
Sbjct: 142 LKPLSTVFM 150


>BT007297-1|AAP35961.1|  165|Homo sapiens interferon,
           alpha-inducible protein (clone IFI-15K) protein.
          Length = 165

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V+   G++ T EV  + T+ ++K ++   EG+  +   L F GK LED   L +Y 
Sbjct: 82  LNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYG 141

Query: 447 IQKESTLHL 421
           ++  ST+ +
Sbjct: 142 LKPLSTVFM 150


>BC009507-1|AAH09507.1|  165|Homo sapiens ISG15 ubiquitin-like
           modifier protein.
          Length = 165

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V+   G++ T EV  + T+ ++K ++   EG+  +   L F GK LED   L +Y 
Sbjct: 82  LNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYG 141

Query: 447 IQKESTLHL 421
           ++  ST+ +
Sbjct: 142 LKPLSTVFM 150


>AY168648-1|AAN86983.1|  165|Homo sapiens ubiquitin-like protein
           ISG15 protein.
          Length = 165

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V+   G++ T EV  + T+ ++K ++   EG+  +   L F GK LED   L +Y 
Sbjct: 82  LNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYG 141

Query: 447 IQKESTLHL 421
           ++  ST+ +
Sbjct: 142 LKPLSTVFM 150


>AL645608-12|CAI15574.1|  165|Homo sapiens ISG15 ubiquitin-like
           modifier protein.
          Length = 165

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/69 (30%), Positives = 38/69 (55%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I V+   G++ T EV  + T+ ++K ++   EG+  +   L F GK LED   L +Y 
Sbjct: 82  LSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYG 141

Query: 447 IQKESTLHL 421
           ++  ST+ +
Sbjct: 142 LKPLSTVFM 150


>X85237-1|CAA59494.1|  793|Homo sapiens human splicing factor
           protein.
          Length = 793

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/62 (27%), Positives = 35/62 (56%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ +   +  +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +
Sbjct: 722 LNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVI 781

Query: 426 HL 421
           HL
Sbjct: 782 HL 783


>CR456575-1|CAG30461.1|  793|Homo sapiens SF3A1 protein.
          Length = 793

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/62 (27%), Positives = 35/62 (56%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ +   +  +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +
Sbjct: 722 LNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVI 781

Query: 426 HL 421
           HL
Sbjct: 782 HL 783


>BC007684-1|AAH07684.1|  793|Homo sapiens splicing factor 3a,
           subunit 1, 120kDa protein.
          Length = 793

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/62 (27%), Positives = 35/62 (56%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ +   +  +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +
Sbjct: 722 LNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVI 781

Query: 426 HL 421
           HL
Sbjct: 782 HL 783


>BC001976-1|AAH01976.1|  793|Homo sapiens splicing factor 3a,
           subunit 1, 120kDa protein.
          Length = 793

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/62 (27%), Positives = 35/62 (56%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ +   +  +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +
Sbjct: 722 LNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVI 781

Query: 426 HL 421
           HL
Sbjct: 782 HL 783


>AC004997-4|AAC23435.1|  793|Homo sapiens spliceosome associated
           protein 114 (SF3a) protein.
          Length = 793

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 17/62 (27%), Positives = 35/62 (56%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ +   +  +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +
Sbjct: 722 LNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVI 781

Query: 426 HL 421
           HL
Sbjct: 782 HL 783


>AL445215-3|CAH73683.1|  316|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)core domain 3 (WFDC3)
           protein.
          Length = 316

 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ ++
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQEF 59


>AL132982-3|CAI23603.1|  316|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)visiae) protein.
          Length = 316

 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ ++
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQEF 59


>AL118499-2|CAC00663.1|   18|Homo sapiens chromosome 20 open reading
           frame 109 protein.
          Length = 18

 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/18 (94%), Positives = 18/18 (100%)
 Frame = -1

Query: 579 VEPSDTIENVKAKIQDKE 526
           +EPSDTIENVKAKIQDKE
Sbjct: 1   IEPSDTIENVKAKIQDKE 18


>AL035697-4|CAI21387.1|  316|Homo sapiens Parkinson disease
           (autosomal recessive, juvenile)r 1 protein.
          Length = 316

 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/59 (28%), Positives = 35/59 (59%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           M +FV+  +     +EV+   +I  +K  +  ++G+P +Q R+ FAGK+L +  T+ ++
Sbjct: 1   MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQEF 59


>BC036743-1|AAH36743.1|  655|Homo sapiens ubiquilin 3 protein.
          Length = 655

 Score = 36.3 bits (80), Expect = 0.095
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKT   K     V  + TI+ +K +I  +    P+Q  L FAGK L+D  +L+   
Sbjct: 22  IKVTVKTPKDKE-DFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCG 80

Query: 447 IQKESTLHLV 418
           ++   T+HLV
Sbjct: 81  VRDGLTVHLV 90


>AF230481-1|AAF67143.1|  655|Homo sapiens ubiquilin 3 protein.
          Length = 655

 Score = 36.3 bits (80), Expect = 0.095
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKT   K     V  + TI+ +K +I  +    P+Q  L FAGK L+D  +L+   
Sbjct: 22  IKVTVKTPKDKE-DFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCG 80

Query: 447 IQKESTLHLV 418
           ++   T+HLV
Sbjct: 81  VRDGLTVHLV 90


>AF137396-1|AAG41675.1|  670|Homo sapiens ubiquilin 3 protein.
          Length = 670

 Score = 36.3 bits (80), Expect = 0.095
 Identities = 23/70 (32%), Positives = 38/70 (54%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKT   K     V  + TI+ +K +I  +    P+Q  L FAGK L+D  +L+   
Sbjct: 37  IKVTVKTPKDKE-DFSVTDTCTIQQLKEEISQRFKAHPDQLVLIFAGKILKDPDSLAQCG 95

Query: 447 IQKESTLHLV 418
           ++   T+HLV
Sbjct: 96  VRDGLTVHLV 105


>BC039294-1|AAH39294.1|  589|Homo sapiens ubiquilin 1 protein.
          Length = 589

 Score = 35.9 bits (79), Expect = 0.13
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ VKT   K     V  + +++  K +I  +     +Q  L FAGK L+D  TLS + 
Sbjct: 37  MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHG 95

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 96  IHDGLTVHLV 105


>BC010066-1|AAH10066.1|  561|Homo sapiens ubiquilin 1 protein.
          Length = 561

 Score = 35.9 bits (79), Expect = 0.13
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ VKT   K     V  + +++  K +I  +     +Q  L FAGK L+D  TLS + 
Sbjct: 37  MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHG 95

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 96  IHDGLTVHLV 105


>AL354920-5|CAI15101.1|  589|Homo sapiens ubiquilin 1 protein.
          Length = 589

 Score = 35.9 bits (79), Expect = 0.13
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ VKT   K     V  + +++  K +I  +     +Q  L FAGK L+D  TLS + 
Sbjct: 37  MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHG 95

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 96  IHDGLTVHLV 105


>AL354920-4|CAI15100.1|  561|Homo sapiens ubiquilin 1 protein.
          Length = 561

 Score = 35.9 bits (79), Expect = 0.13
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ VKT   K     V  + +++  K +I  +     +Q  L FAGK L+D  TLS + 
Sbjct: 37  MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHG 95

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 96  IHDGLTVHLV 105


>AK074535-1|BAC11045.1|  316|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90054 fis, clone HEMBA1002992, weakly similar to
           UBIQUITIN-LIKE PROTEIN DSK2. ).
          Length = 316

 Score = 35.9 bits (79), Expect = 0.13
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ VKT   K     V  + +++  K +I  +     +Q  L FAGK L+D  TLS + 
Sbjct: 37  MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHG 95

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 96  IHDGLTVHLV 105


>AF293384-1|AAG02473.1|  589|Homo sapiens PLIC-1 protein.
          Length = 589

 Score = 35.9 bits (79), Expect = 0.13
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ VKT   K     V  + +++  K +I  +     +Q  L FAGK L+D  TLS + 
Sbjct: 37  MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHG 95

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 96  IHDGLTVHLV 105


>AF176069-1|AAD49751.3|  589|Homo sapiens ubiquilin protein.
          Length = 589

 Score = 35.9 bits (79), Expect = 0.13
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++ VKT   K     V  + +++  K +I  +     +Q  L FAGK L+D  TLS + 
Sbjct: 37  MKVTVKTPKEKE-EFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHG 95

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 96  IHDGLTVHLV 105


>BC063841-1|AAH63841.1|  601|Homo sapiens ubiquilin 4 protein.
          Length = 601

 Score = 35.1 bits (77), Expect = 0.22
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R  +++ VKT   K   +  + + +++  K +I  +     +Q  L FAGK L+DG TL+
Sbjct: 10  RPPIRVTVKTPKDKEEIVICDRA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLN 68

Query: 456 DYNIQKESTLHLV 418
            + I+   T+HLV
Sbjct: 69  QHGIKDGLTVHLV 81


>BC018403-1|AAH18403.1|  601|Homo sapiens ubiquilin 4 protein.
          Length = 601

 Score = 35.1 bits (77), Expect = 0.22
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R  +++ VKT   K   +  + + +++  K +I  +     +Q  L FAGK L+DG TL+
Sbjct: 10  RPPIRVTVKTPKDKEEIVICDRA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLN 68

Query: 456 DYNIQKESTLHLV 418
            + I+   T+HLV
Sbjct: 69  QHGIKDGLTVHLV 81


>AL355388-14|CAH72633.1|  601|Homo sapiens ubiquilin 4 protein.
          Length = 601

 Score = 35.1 bits (77), Expect = 0.22
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R  +++ VKT   K   +  + + +++  K +I  +     +Q  L FAGK L+DG TL+
Sbjct: 10  RPPIRVTVKTPKDKEEIVICDRA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLN 68

Query: 456 DYNIQKESTLHLV 418
            + I+   T+HLV
Sbjct: 69  QHGIKDGLTVHLV 81


>AL355388-13|CAH72634.1|  226|Homo sapiens ubiquilin 4 protein.
          Length = 226

 Score = 35.1 bits (77), Expect = 0.22
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R  +++ VKT   K   +  + + +++  K +I  +     +Q  L FAGK L+DG TL+
Sbjct: 10  RPPIRVTVKTPKDKEEIVICDRA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLN 68

Query: 456 DYNIQKESTLHLV 418
            + I+   T+HLV
Sbjct: 69  QHGIKDGLTVHLV 81


>AK023354-1|BAB14539.1|  314|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13292 fis, clone OVARC1001180, weakly similar to
           UBIQUITIN-LIKE PROTEIN DSK2. ).
          Length = 314

 Score = 35.1 bits (77), Expect = 0.22
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R  +++ VKT   K   +  + + +++  K +I  +     +Q  L FAGK L+DG TL+
Sbjct: 10  RPPIRVTVKTPKDKEEIVICDRA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLN 68

Query: 456 DYNIQKESTLHLV 418
            + I+   T+HLV
Sbjct: 69  QHGIKDGLTVHLV 81


>AF188240-1|AAF80171.1|  601|Homo sapiens A1U protein.
          Length = 601

 Score = 35.1 bits (77), Expect = 0.22
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R  +++ VKT   K   +  + + +++  K +I  +     +Q  L FAGK L+DG TL+
Sbjct: 10  RPPIRVTVKTPKDKEEIVICDRA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLN 68

Query: 456 DYNIQKESTLHLV 418
            + I+   T+HLV
Sbjct: 69  QHGIKDGLTVHLV 81


>AB209566-1|BAD92803.1|  600|Homo sapiens ataxin-1 ubiquitin-like
           interacting protein variant protein.
          Length = 600

 Score = 35.1 bits (77), Expect = 0.22
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = -1

Query: 636 RVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLS 457
           R  +++ VKT   K   +  + + +++  K +I  +     +Q  L FAGK L+DG TL+
Sbjct: 9   RPPIRVTVKTPKDKEEIVICDRA-SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLN 67

Query: 456 DYNIQKESTLHLV 418
            + I+   T+HLV
Sbjct: 68  QHGIKDGLTVHLV 80


>L42856-1|AAA75522.1|  118|Homo sapiens RNA polymerase II
           transcription factor SIII p18 subunit protein.
          Length = 118

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKT-ITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M +F+     KT I  + + S T+  +K  ++     PP++QRL    + L+DG+TL +
Sbjct: 1   MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGE 59


>BC069237-1|AAH69237.1|  624|Homo sapiens UBQLN2 protein protein.
          Length = 624

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKT   K     V  + +++  K  I  +     +Q  L FAGK L+D  TL  + 
Sbjct: 33  IKVTVKTPKEKE-EFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHG 91

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 92  IHDGLTVHLV 101


>BC065000-1|AAH65000.1|  118|Homo sapiens transcription elongation
           factor B (SIII), polypeptide 2 (18kDa, elongin B)
           protein.
          Length = 118

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKT-ITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M +F+     KT I  + + S T+  +K  ++     PP++QRL    + L+DG+TL +
Sbjct: 1   MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGE 59


>BC013306-1|AAH13306.1|  118|Homo sapiens transcription elongation
           factor B (SIII), polypeptide 2 (18kDa, elongin B)
           protein.
          Length = 118

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKT-ITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M +F+     KT I  + + S T+  +K  ++     PP++QRL    + L+DG+TL +
Sbjct: 1   MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGE 59


>AL354793-1|CAD13519.1|  624|Homo sapiens ubiquilin 2 protein.
          Length = 624

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKT   K     V  + +++  K  I  +     +Q  L FAGK L+D  TL  + 
Sbjct: 33  IKVTVKTPKEKE-EFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHG 91

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 92  IHDGLTVHLV 101


>AF293385-1|AAG02474.1|  624|Homo sapiens PLIC-2 protein.
          Length = 624

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKT   K     V  + +++  K  I  +     +Q  L FAGK L+D  TL  + 
Sbjct: 33  IKVTVKTPKEKE-EFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHG 91

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 92  IHDGLTVHLV 101


>AF189009-1|AAF17237.1|  624|Homo sapiens ubiquitin-like product
           Chap1/Dsk2 protein.
          Length = 624

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           +++ VKT   K     V  + +++  K  I  +     +Q  L FAGK L+D  TL  + 
Sbjct: 33  IKVTVKTPKEKE-EFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHG 91

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 92  IHDGLTVHLV 101


>AB035275-1|BAB20436.1|  589|Homo sapiens DA41 protein.
          Length = 589

 Score = 31.5 bits (68), Expect = 2.7
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M++  KT   K     V  + +++  K +I  +     +Q  L FAGK L+D  T S + 
Sbjct: 37  MKVTAKTPKEKE-EFAVPENSSVQQSKEEISKRFKSHTDQLVLIFAGKILKDQDTSSQHG 95

Query: 447 IQKESTLHLV 418
           I    T+HLV
Sbjct: 96  IHDGLTVHLV 105


>BC108694-1|AAI08695.1|  420|Homo sapiens IKBKB protein protein.
          Length = 420

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL 499
           +K+   +  +TG   T  V   ++++++KA+IQ   GIP   Q L
Sbjct: 309 LKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQEL 353


>AY663108-1|AAT65965.1|  756|Homo sapiens inhibitor of kappa light
           polypeptide gene enhancer in B-cells, kinase beta
           protein.
          Length = 756

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL 499
           +K+   +  +TG   T  V   ++++++KA+IQ   GIP   Q L
Sbjct: 309 LKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQEL 353


>AF080158-1|AAD08997.1|  756|Homo sapiens IkB kinase-b protein.
          Length = 756

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL 499
           +K+   +  +TG   T  V   ++++++KA+IQ   GIP   Q L
Sbjct: 309 LKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQEL 353


>AF031416-1|AAC64675.1|  756|Homo sapiens IkB kinase beta subunit
           protein.
          Length = 756

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL 499
           +K+   +  +TG   T  V   ++++++KA+IQ   GIP   Q L
Sbjct: 309 LKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQEL 353


>AF029684-1|AAC51860.1|  756|Homo sapiens IkB kinase-beta protein.
          Length = 756

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL 499
           +K+   +  +TG   T  V   ++++++KA+IQ   GIP   Q L
Sbjct: 309 LKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQEL 353


>AB209090-1|BAD92327.1|  483|Homo sapiens inhibitor of kappa light
           polypeptide gene enhancer in B-cells, kinase beta vari
           protein.
          Length = 483

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRL 499
           +K+   +  +TG   T  V   ++++++KA+IQ   GIP   Q L
Sbjct: 260 LKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQEL 304


>AL442081-1|CAC09446.1|  588|Homo sapiens hypothetical protein
           protein.
          Length = 588

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = -1

Query: 579 VEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           V  + +++  K  I  +     +Q  L FAGK L+D  TL  + I    T+HLV
Sbjct: 12  VPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLV 65


>AL157766-3|CAI13923.2|  728|Homo sapiens spastic ataxia of
           Charlevoix-Saguenay (sacsin) protein.
          Length = 728

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = -1

Query: 588 TLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           T+    S T+ +VK +I  + G P ++QRL   G++L D   + D
Sbjct: 22  TVAALASWTVRDVKERIFAETGFPVSEQRLWRGGRELSDWIKIGD 66


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,548,622
Number of Sequences: 237096
Number of extensions: 1558179
Number of successful extensions: 3530
Number of sequences better than 10.0: 250
Number of HSP's better than 10.0 without gapping: 3275
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3524
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7310122300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -