SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC029067-1|AAH29067.1|   65|Homo sapiens chromosome 13 open read...   100   3e-21
AL138960-2|CAI12995.1|   65|Homo sapiens RP11-269C23.1 protein.       100   3e-21
CR533472-1|CAG38503.1|   66|Homo sapiens SERP1 protein.                90   5e-18
BC112365-1|AAI12366.1|   66|Homo sapiens stress-associated endop...    90   5e-18
BC112364-1|AAI12365.1|   66|Homo sapiens stress-associated endop...    90   5e-18
BC108314-1|AAI08315.1|   66|Homo sapiens stress-associated endop...    90   5e-18
AF136975-1|AAG49436.1|   66|Homo sapiens ribosome attached membr...    90   5e-18
AB022427-1|BAA81895.1|   66|Homo sapiens SERP1 protein.                90   5e-18
BC029488-1|AAH29488.1|  294|Homo sapiens sperm acrosome associat...    33   0.58 
AL136096-1|CAI19915.1|  294|Homo sapiens sperm acrosome associat...    33   0.58 
AF203447-1|AAG31422.1|  294|Homo sapiens sperm acrosome membrane...    33   0.58 
BC128392-1|AAI28393.1|  782|Homo sapiens zinc finger protein 786...    29   7.1  
BC109245-1|AAI09246.1|  753|Homo sapiens ZNF786 protein protein.       29   7.1  

>BC029067-1|AAH29067.1|   65|Homo sapiens chromosome 13 open reading
           frame 21 protein.
          Length = 65

 Score =  100 bits (239), Expect = 3e-21
 Identities = 45/63 (71%), Positives = 54/63 (85%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           M  KQR+R+ANE  SKNIT RGNV KT + +E++YPV PWLLALF+FVVCGSA+FQIIQS
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQS 60

Query: 280 IRL 288
           IR+
Sbjct: 61  IRM 63


>AL138960-2|CAI12995.1|   65|Homo sapiens RP11-269C23.1 protein.
          Length = 65

 Score =  100 bits (239), Expect = 3e-21
 Identities = 45/63 (71%), Positives = 54/63 (85%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           M  KQR+R+ANE  SKNIT RGNV KT + +E++YPV PWLLALF+FVVCGSA+FQIIQS
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQS 60

Query: 280 IRL 288
           IR+
Sbjct: 61  IRM 63


>CR533472-1|CAG38503.1|   66|Homo sapiens SERP1 protein.
          Length = 66

 Score = 89.8 bits (213), Expect = 5e-18
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQIIQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ 60

Query: 277 SIRL 288
           SIR+
Sbjct: 61  SIRM 64


>BC112365-1|AAI12366.1|   66|Homo sapiens stress-associated
           endoplasmic reticulum protein 1 protein.
          Length = 66

 Score = 89.8 bits (213), Expect = 5e-18
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQIIQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ 60

Query: 277 SIRL 288
           SIR+
Sbjct: 61  SIRM 64


>BC112364-1|AAI12365.1|   66|Homo sapiens stress-associated
           endoplasmic reticulum protein 1 protein.
          Length = 66

 Score = 89.8 bits (213), Expect = 5e-18
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQIIQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ 60

Query: 277 SIRL 288
           SIR+
Sbjct: 61  SIRM 64


>BC108314-1|AAI08315.1|   66|Homo sapiens stress-associated
           endoplasmic reticulum protein 1 protein.
          Length = 66

 Score = 89.8 bits (213), Expect = 5e-18
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQIIQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ 60

Query: 277 SIRL 288
           SIR+
Sbjct: 61  SIRM 64


>AF136975-1|AAG49436.1|   66|Homo sapiens ribosome attached membrane
           protein 4 protein.
          Length = 66

 Score = 89.8 bits (213), Expect = 5e-18
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQIIQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ 60

Query: 277 SIRL 288
           SIR+
Sbjct: 61  SIRM 64


>AB022427-1|BAA81895.1|   66|Homo sapiens SERP1 protein.
          Length = 66

 Score = 89.8 bits (213), Expect = 5e-18
 Identities = 44/64 (68%), Positives = 52/64 (81%), Gaps = 1/64 (1%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEK-EDQYPVAPWLLALFIFVVCGSAVFQIIQ 276
           M  KQR+R+ANE  SKNIT RGNV KT++   E++  V PWLLALFIFVVCGSA+FQIIQ
Sbjct: 1   MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQ 60

Query: 277 SIRL 288
           SIR+
Sbjct: 61  SIRM 64


>BC029488-1|AAH29488.1|  294|Homo sapiens sperm acrosome associated
           1 protein.
          Length = 294

 Score = 33.1 bits (72), Expect = 0.58
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +3

Query: 159 EGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDNPINK 284
           E +C    +  R P  CG   P S  L SV L C+  +P+N+
Sbjct: 105 ESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNR 146


>AL136096-1|CAI19915.1|  294|Homo sapiens sperm acrosome associated
           1 protein.
          Length = 294

 Score = 33.1 bits (72), Expect = 0.58
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +3

Query: 159 EGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDNPINK 284
           E +C    +  R P  CG   P S  L SV L C+  +P+N+
Sbjct: 105 ESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNR 146


>AF203447-1|AAG31422.1|  294|Homo sapiens sperm acrosome membrane
           protein SAMP32 protein.
          Length = 294

 Score = 33.1 bits (72), Expect = 0.58
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +3

Query: 159 EGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDNPINK 284
           E +C    +  R P  CG   P S  L SV L C+  +P+N+
Sbjct: 105 ESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNR 146


>BC128392-1|AAI28393.1|  782|Homo sapiens zinc finger protein 786
           protein.
          Length = 782

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = +3

Query: 117 NAYRQRDRQ*KHHN-EGECTQNYQGKRRPISCGTLAPCSLH 236
           N++++ D +   H  EG C+ +  G+R P+S    +PC  H
Sbjct: 351 NSHQEGDTEALQHGAEGPCSCSECGERSPMSARLASPCRAH 391


>BC109245-1|AAI09246.1|  753|Homo sapiens ZNF786 protein protein.
          Length = 753

 Score = 29.5 bits (63), Expect = 7.1
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = +3

Query: 117 NAYRQRDRQ*KHHN-EGECTQNYQGKRRPISCGTLAPCSLH 236
           N++++ D +   H  EG C+ +  G+R P+S    +PC  H
Sbjct: 322 NSHQEGDTEALQHGAEGPCSCSECGERSPMSARLASPCRAH 362


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,803,861
Number of Sequences: 237096
Number of extensions: 1591602
Number of successful extensions: 3330
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 3196
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3324
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4763295768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -