SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC041098-1|AAH41098.1| 1531|Homo sapiens UDP-glucose ceramide gl...    32   2.0  
AF227905-1|AAF66232.1| 1555|Homo sapiens UDP-glucose:glycoprotei...    32   2.0  
AC108059-1|AAY14885.1|  688|Homo sapiens unknown protein.              32   2.0  
AF021994-1|AAC09128.1|  129|Homo sapiens Ig heavy chain variable...    31   3.6  
AJ130711-1|CAB51127.1|  374|Homo sapiens QA79 membrane protein, ...    30   6.2  
AF193441-1|AAF06790.1|  374|Homo sapiens Siglec-7 protein.             30   6.2  
AF178981-1|AAF44346.1|  316|Homo sapiens D-siglec precursor prot...    30   6.2  

>BC041098-1|AAH41098.1| 1531|Homo sapiens UDP-glucose ceramide
           glucosyltransferase-like 1 protein.
          Length = 1531

 Score = 31.9 bits (69), Expect = 2.0
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 1/67 (1%)
 Frame = -3

Query: 299 SLATKG-STSKLTQPTEFLAGPSQ*VFWFEPRKSTRPQETDIASQGYHYQHR*KKQSRQF 123
           SL TK  ST  L + +EFLA  SQ  FW     S     +D     Y Y H   + + QF
Sbjct: 26  SLTTKWFSTPLLLEASEFLAEDSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQF 85

Query: 122 LVCAEHN 102
           L   + N
Sbjct: 86  LSPLQQN 92


>AF227905-1|AAF66232.1| 1555|Homo sapiens UDP-glucose:glycoprotein
           glucosyltransferase 1 precursor protein.
          Length = 1555

 Score = 31.9 bits (69), Expect = 2.0
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 1/67 (1%)
 Frame = -3

Query: 299 SLATKG-STSKLTQPTEFLAGPSQ*VFWFEPRKSTRPQETDIASQGYHYQHR*KKQSRQF 123
           SL TK  ST  L + +EFLA  SQ  FW     S     +D     Y Y H   + + QF
Sbjct: 50  SLTTKWFSTPLLLEASEFLAEDSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQF 109

Query: 122 LVCAEHN 102
           L   + N
Sbjct: 110 LSPLQQN 116


>AC108059-1|AAY14885.1|  688|Homo sapiens unknown protein.
          Length = 688

 Score = 31.9 bits (69), Expect = 2.0
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 1/67 (1%)
 Frame = -3

Query: 299 SLATKG-STSKLTQPTEFLAGPSQ*VFWFEPRKSTRPQETDIASQGYHYQHR*KKQSRQF 123
           SL TK  ST  L + +EFLA  SQ  FW     S     +D     Y Y H   + + QF
Sbjct: 26  SLTTKWFSTPLLLEASEFLAEDSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQF 85

Query: 122 LVCAEHN 102
           L   + N
Sbjct: 86  LSPLQQN 92


>AF021994-1|AAC09128.1|  129|Homo sapiens Ig heavy chain variable
           region protein.
          Length = 129

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 15/45 (33%), Positives = 26/45 (57%)
 Frame = -3

Query: 467 RTSALNNR*VHISYVK*IDTAAVFISQSPKRHYGSSRSLNGAFKY 333
           R +A N+  +HIS ++  DTA  +  +  ++HY  SR LN  + +
Sbjct: 72  RDNAKNSLFLHISNLRAEDTAEYYCVKGVEKHYYDSRGLNWVYYF 116


>AJ130711-1|CAB51127.1|  374|Homo sapiens QA79 membrane protein,
           splice product airm-2 protein.
          Length = 374

 Score = 30.3 bits (65), Expect = 6.2
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = -1

Query: 460 RL*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTV 344
           R+   GRY F M   +I+  Y Y +    +TDPP  LTV
Sbjct: 114 RMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTDPPQNLTV 152


>AF193441-1|AAF06790.1|  374|Homo sapiens Siglec-7 protein.
          Length = 374

 Score = 30.3 bits (65), Expect = 6.2
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = -1

Query: 460 RL*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTV 344
           R+   GRY F M   +I+  Y Y +    +TDPP  LTV
Sbjct: 114 RMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTDPPQNLTV 152


>AF178981-1|AAF44346.1|  316|Homo sapiens D-siglec precursor
           protein.
          Length = 316

 Score = 30.3 bits (65), Expect = 6.2
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = -1

Query: 460 RL*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTV 344
           R+   GRY F M   +I+  Y Y +    +TDPP  LTV
Sbjct: 114 RMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTDPPQNLTV 152


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,330,356
Number of Sequences: 237096
Number of extensions: 1979641
Number of successful extensions: 3869
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 3734
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3868
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7253890590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -