SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC018151-1|AAH18151.1|  204|Homo sapiens ribosomal protein S5 pr...   324   1e-88
BC015405-1|AAH15405.1|  204|Homo sapiens ribosomal protein S5 pr...   324   1e-88
AK223106-1|BAD96826.1|  204|Homo sapiens ribosomal protein S5 va...   324   1e-88
AB061853-1|BAB79493.1|  204|Homo sapiens ribosomal protein S5 pr...   324   1e-88
U14970-1|AAA85658.1|  204|Homo sapiens ribosomal protein S5 prot...   320   3e-87
AB209803-1|BAD93040.1|  107|Homo sapiens ribosomal protein S5 va...    92   1e-18
AB007149-1|BAA25815.1|   55|Homo sapiens ribosomal protein S5 pr...    63   1e-09
AB231860-1|BAE19678.1| 1640|Homo sapiens hypothetical protein pr...    34   0.39 
AL513320-1|CAI14334.1| 1229|Homo sapiens multiple EGF-like-domai...    31   3.6  
AL512413-3|CAH70834.1| 1229|Homo sapiens multiple EGF-like-domai...    31   3.6  
AB011539-1|BAA32467.2| 1246|Homo sapiens MEGF6 protein.                31   3.6  
D86966-1|BAA13202.2| 1317|Homo sapiens KIAA0211 protein.               31   4.7  
BC112234-1|AAI12235.1| 1267|Homo sapiens zinc finger protein 592...    31   4.7  
BC112232-1|AAI12233.1| 1267|Homo sapiens zinc finger protein 592...    31   4.7  
BC094688-1|AAH94688.1| 1267|Homo sapiens zinc finger protein 592...    31   4.7  
AK127866-1|BAC87168.1|  204|Homo sapiens protein ( Homo sapiens ...    30   8.3  
AK126695-1|BAC86646.1|  398|Homo sapiens protein ( Homo sapiens ...    30   8.3  
AK023048-1|BAB14374.1|  171|Homo sapiens protein ( Homo sapiens ...    30   8.3  

>BC018151-1|AAH18151.1|  204|Homo sapiens ribosomal protein S5
           protein.
          Length = 204

 Score =  324 bits (797), Expect = 1e-88
 Identities = 153/170 (90%), Positives = 162/170 (95%)
 Frame = +2

Query: 143 PQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPI 322
           P  A+ P+IKLFG+WS  DVQ++D+SLQDYI+VKEKYAKYLPHSAGRYA KRFRKAQCPI
Sbjct: 9   PAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPI 68

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRI 502
           VERLTNS+MMHGRNNGKKLM VRIVKHAFEIIHLLTGENPLQVLV AIINSGPREDSTRI
Sbjct: 69  VERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRI 128

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+ADELI
Sbjct: 129 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELI 178


>BC015405-1|AAH15405.1|  204|Homo sapiens ribosomal protein S5
           protein.
          Length = 204

 Score =  324 bits (797), Expect = 1e-88
 Identities = 153/170 (90%), Positives = 162/170 (95%)
 Frame = +2

Query: 143 PQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPI 322
           P  A+ P+IKLFG+WS  DVQ++D+SLQDYI+VKEKYAKYLPHSAGRYA KRFRKAQCPI
Sbjct: 9   PAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPI 68

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRI 502
           VERLTNS+MMHGRNNGKKLM VRIVKHAFEIIHLLTGENPLQVLV AIINSGPREDSTRI
Sbjct: 69  VERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRI 128

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+ADELI
Sbjct: 129 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELI 178


>AK223106-1|BAD96826.1|  204|Homo sapiens ribosomal protein S5
           variant protein.
          Length = 204

 Score =  324 bits (797), Expect = 1e-88
 Identities = 153/170 (90%), Positives = 162/170 (95%)
 Frame = +2

Query: 143 PQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPI 322
           P  A+ P+IKLFG+WS  DVQ++D+SLQDYI+VKEKYAKYLPHSAGRYA KRFRKAQCPI
Sbjct: 9   PAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPI 68

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRI 502
           VERLTNS+MMHGRNNGKKLM VRIVKHAFEIIHLLTGENPLQVLV AIINSGPREDSTRI
Sbjct: 69  VERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRI 128

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+ADELI
Sbjct: 129 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELI 178


>AB061853-1|BAB79493.1|  204|Homo sapiens ribosomal protein S5
           protein.
          Length = 204

 Score =  324 bits (797), Expect = 1e-88
 Identities = 153/170 (90%), Positives = 162/170 (95%)
 Frame = +2

Query: 143 PQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPI 322
           P  A+ P+IKLFG+WS  DVQ++D+SLQDYI+VKEKYAKYLPHSAGRYA KRFRKAQCPI
Sbjct: 9   PAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPI 68

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRI 502
           VERLTNS+MMHGRNNGKKLM VRIVKHAFEIIHLLTGENPLQVLV AIINSGPREDSTRI
Sbjct: 69  VERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRI 128

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+ADELI
Sbjct: 129 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELI 178


>U14970-1|AAA85658.1|  204|Homo sapiens ribosomal protein S5
           protein.
          Length = 204

 Score =  320 bits (786), Expect = 3e-87
 Identities = 151/170 (88%), Positives = 160/170 (94%)
 Frame = +2

Query: 143 PQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPI 322
           P  A+ P+IKLFG+WS  DVQ++D+SLQDYI+VKEKYAKYLPHSAGRYA   FRKAQCPI
Sbjct: 9   PAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAANAFRKAQCPI 68

Query: 323 VERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRI 502
           VERLTNS+MMHGRNNGKKLM VRIVKHAFEIIHLLTGENPLQVLV AIINSGPREDSTRI
Sbjct: 69  VERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRI 128

Query: 503 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELI 652
           GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+ADELI
Sbjct: 129 GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELI 178


>AB209803-1|BAD93040.1|  107|Homo sapiens ribosomal protein S5
           variant protein.
          Length = 107

 Score = 92.3 bits (219), Expect = 1e-18
 Identities = 45/52 (86%), Positives = 46/52 (88%)
 Frame = +2

Query: 308 AQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTA 463
           AQCPIVERLTNS+MMHGRNNGKKLM VRIVKHAFEIIHLLTGE  L  LV A
Sbjct: 1   AQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGEVGLCGLVRA 52


>AB007149-1|BAA25815.1|   55|Homo sapiens ribosomal protein S5
           protein.
          Length = 55

 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = +2

Query: 566 AIWLLCTGAREAAFRNIKTIAECVADELI 652
           AIWLLCTGAREAAFRNIKTIAEC+ADELI
Sbjct: 1   AIWLLCTGAREAAFRNIKTIAECLADELI 29


>AB231860-1|BAE19678.1| 1640|Homo sapiens hypothetical protein
            protein.
          Length = 1640

 Score = 34.3 bits (75), Expect = 0.39
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -1

Query: 371  CHCSDRASLESL*GAPRLGTGLYGNACVHTC 279
            C C + ++ E   G  R G G YG AC H C
Sbjct: 1423 CSCHNNSTCEPATGTCRCGPGFYGQACEHPC 1453


>AL513320-1|CAI14334.1| 1229|Homo sapiens multiple EGF-like-domains 6
            protein.
          Length = 1229

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -1

Query: 371  CHCSDRASLESL*GAPRLGTGLYGNACVH 285
            C C + ++ E   G  R G G YG AC H
Sbjct: 1113 CSCHNNSTCEPATGTCRCGPGFYGQACEH 1141


>AL512413-3|CAH70834.1| 1229|Homo sapiens multiple EGF-like-domains 6
            protein.
          Length = 1229

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -1

Query: 371  CHCSDRASLESL*GAPRLGTGLYGNACVH 285
            C C + ++ E   G  R G G YG AC H
Sbjct: 1113 CSCHNNSTCEPATGTCRCGPGFYGQACEH 1141


>AB011539-1|BAA32467.2| 1246|Homo sapiens MEGF6 protein.
          Length = 1246

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -1

Query: 371  CHCSDRASLESL*GAPRLGTGLYGNACVH 285
            C C + ++ E   G  R G G YG AC H
Sbjct: 1130 CSCHNNSTCEPATGTCRCGPGFYGQACEH 1158


>D86966-1|BAA13202.2| 1317|Homo sapiens KIAA0211 protein.
          Length = 1317

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +2

Query: 224  QDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNN 367
            Q+++  +E Y  ++  S GR   KR+   QC       NSL  H RNN
Sbjct: 1039 QEWVPDRESYVSHMKKSHGRTL-KRYPCRQCEQSFHTPNSLRKHIRNN 1085


>BC112234-1|AAI12235.1| 1267|Homo sapiens zinc finger protein 592
            protein.
          Length = 1267

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +2

Query: 224  QDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNN 367
            Q+++  +E Y  ++  S GR   KR+   QC       NSL  H RNN
Sbjct: 989  QEWVPDRESYVSHMKKSHGRTL-KRYPCRQCEQSFHTPNSLRKHIRNN 1035


>BC112232-1|AAI12233.1| 1267|Homo sapiens zinc finger protein 592
            protein.
          Length = 1267

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +2

Query: 224  QDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNN 367
            Q+++  +E Y  ++  S GR   KR+   QC       NSL  H RNN
Sbjct: 989  QEWVPDRESYVSHMKKSHGRTL-KRYPCRQCEQSFHTPNSLRKHIRNN 1035


>BC094688-1|AAH94688.1| 1267|Homo sapiens zinc finger protein 592
            protein.
          Length = 1267

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +2

Query: 224  QDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNN 367
            Q+++  +E Y  ++  S GR   KR+   QC       NSL  H RNN
Sbjct: 989  QEWVPDRESYVSHMKKSHGRTL-KRYPCRQCEQSFHTPNSLRKHIRNN 1035


>AK127866-1|BAC87168.1|  204|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45969 fis, clone PLACE7016454. ).
          Length = 204

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = -2

Query: 631 LCDCFNISECSLTCTCAQKPDCLVDSAQG*NINGL 527
           LC C ++  C+  C C  K  C   S Q  ++NG+
Sbjct: 45  LCVCVHVCICACICACVWKFPCRNHSVQTESLNGV 79


>AK126695-1|BAC86646.1|  398|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44741 fis, clone BRACE3027931. ).
          Length = 398

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +3

Query: 198 MCKSLICLCRTTFPLKRSTQNIYLIQLA 281
           +CKS  C+C +T  +  ST+  Y  QLA
Sbjct: 259 VCKSTYCICNSTHCVCNSTRTAYATQLA 286


>AK023048-1|BAB14374.1|  171|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12986 fis, clone NT2RP3000055. ).
          Length = 171

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +3

Query: 198 MCKSLICLCRTTFPLKRSTQNIYLIQLA 281
           +CKS  C+C +T  +  ST+  Y  QLA
Sbjct: 32  VCKSTYCICNSTHCVCNSTRTAYATQLA 59


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,322,874
Number of Sequences: 237096
Number of extensions: 1964334
Number of successful extensions: 4104
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 3833
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4101
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7310122300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -