SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X89401-1|CAA61582.1|  160|Homo sapiens ribosomal protein L21 pro...   197   2e-50
U14967-1|AAA85655.1|  160|Homo sapiens ribosomal protein L21 pro...   197   2e-50
CR457032-1|CAG33313.1|  160|Homo sapiens RPL21 protein.               197   2e-50
BC104667-1|AAI04668.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
BC071902-1|AAH71902.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
BC070330-1|AAH70330.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
BC070323-1|AAH70323.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
BC070184-1|AAH70184.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
BC062981-1|AAH62981.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
BC007505-1|AAH07505.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
BC001603-1|AAH01603.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
AL159977-1|CAH73745.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
AB061826-1|BAB79464.1|  160|Homo sapiens ribosomal protein L21 p...   197   2e-50
L38826-1|AAA80462.1|  152|Homo sapiens L21 ribosomal protein pro...   195   1e-49
AB209100-1|BAD92337.1|  163|Homo sapiens ribosomal protein L21 v...   188   8e-48
U25789-1|AAA93231.1|  160|Homo sapiens ribosomal protein L21 pro...   184   2e-46
BC057822-1|AAH57822.1|  136|Homo sapiens similar to 60S ribosoma...   109   8e-24
AB007176-1|BAA25835.1|   31|Homo sapiens ribosomal protein L21 p...    36   0.12 
CR541829-1|CAG46628.1|  268|Homo sapiens TM4SF9 protein.               30   6.1  
CR541809-1|CAG46608.1|  268|Homo sapiens TM4SF9 protein.               30   6.1  
BC009704-1|AAH09704.1|  268|Homo sapiens tetraspanin 5 protein.        30   6.1  
AF065389-1|AAC17120.1|  268|Homo sapiens tetraspan NET-4 protein.      30   6.1  
AF053455-1|AAC69712.1|  264|Homo sapiens tetraspan TM4SF protein.      30   6.1  
BC130292-1|AAI30293.1|  418|Homo sapiens sprouty-related, EVH1 d...    29   8.1  
BC111495-1|AAI11496.1|  415|Homo sapiens SPRED2 protein protein.       29   8.1  
AY299090-1|AAP59415.1|  418|Homo sapiens SPRED2 protein.               29   8.1  

>X89401-1|CAA61582.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>U14967-1|AAA85655.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>CR457032-1|CAG33313.1|  160|Homo sapiens RPL21 protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC104667-1|AAI04668.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC071902-1|AAH71902.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC070330-1|AAH70330.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC070323-1|AAH70323.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC070184-1|AAH70184.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC062981-1|AAH62981.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC007505-1|AAH07505.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC001603-1|AAH01603.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>AL159977-1|CAH73745.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>AB061826-1|BAB79464.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  197 bits (480), Expect = 2e-50
 Identities = 88/131 (67%), Positives = 108/131 (82%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKRQPAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>L38826-1|AAA80462.1|  152|Homo sapiens L21 ribosomal protein
           protein.
          Length = 152

 Score =  195 bits (475), Expect = 1e-49
 Identities = 87/131 (66%), Positives = 107/131 (81%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 22  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 81

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R  FLKRVKEN++  KEAK  G  V LKR PAPP+ AH V +  ++P 
Sbjct: 82  NVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRHPAPPREAHFVRTNGKEPE 141

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 142 LLEPIPYEFMA 152


>AB209100-1|BAD92337.1|  163|Homo sapiens ribosomal protein L21
           variant protein.
          Length = 163

 Score =  188 bits (459), Expect = 8e-48
 Identities = 85/131 (64%), Positives = 106/131 (80%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM+VYK GDIVDI+G G VQKGMPH  YHGKTGRVYNVT HA+G++VNK+V+G+I+ KRI
Sbjct: 33  YMRVYKKGDIVDIKGMGTVQKGMPHTRYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRI 92

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK +  FLKRVKEN++  KEAK     + LKRQPAPP+ AH V +  ++P 
Sbjct: 93  NVRIEHIKHSKSQDSFLKRVKENDQKKKEAKEKVTWIQLKRQPAPPREAHFVRTNGKEPE 152

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 153 LLEPIPYEFMA 163


>U25789-1|AAA93231.1|  160|Homo sapiens ribosomal protein L21
           protein.
          Length = 160

 Score =  184 bits (447), Expect = 2e-46
 Identities = 82/131 (62%), Positives = 105/131 (80%), Gaps = 1/131 (0%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM++YK GDIVDI+G G VQKGMPHK YHGKTGRVYNVT HA G++VN++V+G+I+ KRI
Sbjct: 30  YMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAAGIVVNEQVKGKILAKRI 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIV-SGTEKPV 481
           N+R+EH+KHSK R +FLKRVK +++   EA+  G  V LKR PAPP+ AH V +  ++P 
Sbjct: 90  NVRIEHIKHSKSRDNFLKRVKXDDQEKXEAQEKGTWVQLKRXPAPPREAHFVRTNGKEPE 149

Query: 482 LLAPIPYEFVA 514
           LL PIPYEF+A
Sbjct: 150 LLEPIPYEFMA 160


>BC057822-1|AAH57822.1|  136|Homo sapiens similar to 60S ribosomal
           protein L21 protein.
          Length = 136

 Score =  109 bits (261), Expect = 8e-24
 Identities = 57/112 (50%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 182 QKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKR 361
           +K  P  V   K  +VY+V  HA+G++VNK   G+I+ KRIN+ +EH+KH K R  FLK 
Sbjct: 28  KKECPTSVTMAKL-KVYSVPQHAVGIVVNK---GKILAKRINVHIEHIKHCKSRDSFLKC 83

Query: 362 VKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK-PVLLAPIPYEFVA 514
           VKEN++  KEAK  G  V +K QPAPP+ AH V    K P LL PIP EF+A
Sbjct: 84  VKENDQKKKEAKEEGTWVQVKHQPAPPREAHFVKACGKEPELLEPIPCEFMA 135


>AB007176-1|BAA25835.1|   31|Homo sapiens ribosomal protein L21
           protein.
          Length = 31

 Score = 35.5 bits (78), Expect = 0.12
 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = +2

Query: 413 VNLKRQPAPPKAAHIV-SGTEKPVLLAPI 496
           V LKRQPAPP+ AH V +  ++P LL PI
Sbjct: 3   VQLKRQPAPPREAHFVRTNGKEPELLEPI 31


>CR541829-1|CAG46628.1|  268|Homo sapiens TM4SF9 protein.
          Length = 268

 Score = 29.9 bits (64), Expect = 6.1
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 6/58 (10%)
 Frame = -3

Query: 544 FSLKIFYWTLRYEFV------WDRRK*DGFLSSTDDVGSFRGSWLSLQVDGLAGSLGF 389
           F   + +W L   F+      W+ +     +SS  D+G F   WL L V G+   LGF
Sbjct: 20  FGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGGVMFILGF 77


>CR541809-1|CAG46608.1|  268|Homo sapiens TM4SF9 protein.
          Length = 268

 Score = 29.9 bits (64), Expect = 6.1
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 6/58 (10%)
 Frame = -3

Query: 544 FSLKIFYWTLRYEFV------WDRRK*DGFLSSTDDVGSFRGSWLSLQVDGLAGSLGF 389
           F   + +W L   F+      W+ +     +SS  D+G F   WL L V G+   LGF
Sbjct: 20  FGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGGVMFILGF 77


>BC009704-1|AAH09704.1|  268|Homo sapiens tetraspanin 5 protein.
          Length = 268

 Score = 29.9 bits (64), Expect = 6.1
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 6/58 (10%)
 Frame = -3

Query: 544 FSLKIFYWTLRYEFV------WDRRK*DGFLSSTDDVGSFRGSWLSLQVDGLAGSLGF 389
           F   + +W L   F+      W+ +     +SS  D+G F   WL L V G+   LGF
Sbjct: 20  FGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGGVMFILGF 77


>AF065389-1|AAC17120.1|  268|Homo sapiens tetraspan NET-4 protein.
          Length = 268

 Score = 29.9 bits (64), Expect = 6.1
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 6/58 (10%)
 Frame = -3

Query: 544 FSLKIFYWTLRYEFV------WDRRK*DGFLSSTDDVGSFRGSWLSLQVDGLAGSLGF 389
           F   + +W L   F+      W+ +     +SS  D+G F   WL L V G+   LGF
Sbjct: 20  FGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGGVMFILGF 77


>AF053455-1|AAC69712.1|  264|Homo sapiens tetraspan TM4SF protein.
          Length = 264

 Score = 29.9 bits (64), Expect = 6.1
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 6/58 (10%)
 Frame = -3

Query: 544 FSLKIFYWTLRYEFV------WDRRK*DGFLSSTDDVGSFRGSWLSLQVDGLAGSLGF 389
           F   + +W L   F+      W+ +     +SS  D+G F   WL L V G+   LGF
Sbjct: 20  FGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGGVMFILGF 77


>BC130292-1|AAI30293.1|  418|Homo sapiens sprouty-related, EVH1
           domain containing 2 protein.
          Length = 418

 Score = 29.5 bits (63), Expect = 8.1
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)
 Frame = +1

Query: 379 ATEGSQGCRQDR-QPEETASSP*SCPHRQ 462
           AT+ S    Q R QP  T SSP SC HR+
Sbjct: 148 ATDSSSNSSQKREQPTRTISSPTSCEHRR 176


>BC111495-1|AAI11496.1|  415|Homo sapiens SPRED2 protein protein.
          Length = 415

 Score = 29.5 bits (63), Expect = 8.1
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)
 Frame = +1

Query: 379 ATEGSQGCRQDR-QPEETASSP*SCPHRQ 462
           AT+ S    Q R QP  T SSP SC HR+
Sbjct: 148 ATDSSSNSSQKREQPTRTISSPTSCEHRR 176


>AY299090-1|AAP59415.1|  418|Homo sapiens SPRED2 protein.
          Length = 418

 Score = 29.5 bits (63), Expect = 8.1
 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%)
 Frame = +1

Query: 379 ATEGSQGCRQDR-QPEETASSP*SCPHRQ 462
           AT+ S    Q R QP  T SSP SC HR+
Sbjct: 148 ATDSSSNSSQKREQPTRTISSPTSCEHRR 176


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 79,357,167
Number of Sequences: 237096
Number of extensions: 1662723
Number of successful extensions: 8576
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 8208
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8558
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5421005376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -