SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U14973-1|AAA85661.1|   56|Homo sapiens ribosomal protein S29 pro...    77   2e-14
L31610-1|AAB27426.1|   56|Homo sapiens protein ( Homo sapiens (c...    77   2e-14
BC035313-1|AAH35313.1|   56|Homo sapiens ribosomal protein S29 p...    77   2e-14
BC032813-1|AAH32813.1|   56|Homo sapiens ribosomal protein S29 p...    77   2e-14
AB061847-1|BAB79485.1|   56|Homo sapiens ribosomal protein S29 p...    77   2e-14
AB007165-1|BAA25827.1|   26|Homo sapiens ribosomal protein S29 p...    54   2e-07
BC047704-1|AAH47704.1|  183|Homo sapiens SPATA3 protein protein.       29   5.3  
AY032925-1|AAK54455.1|  183|Homo sapiens testis and spermatogene...    29   5.3  
AK093385-1|BAC04149.1|  192|Homo sapiens protein ( Homo sapiens ...    29   5.3  

>U14973-1|AAA85661.1|   56|Homo sapiens ribosomal protein S29
           protein.
          Length = 56

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 32/37 (86%), Positives = 34/37 (91%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR CSNRHGLIRKYGLN+CRQCFR+YA DIGF KLD
Sbjct: 20  SCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIKLD 56



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH  +++SHPR++GQGSR
Sbjct: 1   MGHQQLYWSHPRKFGQGSR 19


>L31610-1|AAB27426.1|   56|Homo sapiens protein ( Homo sapiens
           (clone cori-1cl5) S29 ribosomal protein mRNA, complete
           cds. ).
          Length = 56

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 32/37 (86%), Positives = 34/37 (91%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR CSNRHGLIRKYGLN+CRQCFR+YA DIGF KLD
Sbjct: 20  SCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIKLD 56



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH  +++SHPR++GQGSR
Sbjct: 1   MGHQQLYWSHPRKFGQGSR 19


>BC035313-1|AAH35313.1|   56|Homo sapiens ribosomal protein S29
           protein.
          Length = 56

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 32/37 (86%), Positives = 34/37 (91%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR CSNRHGLIRKYGLN+CRQCFR+YA DIGF KLD
Sbjct: 20  SCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIKLD 56



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH  +++SHPR++GQGSR
Sbjct: 1   MGHQQLYWSHPRKFGQGSR 19


>BC032813-1|AAH32813.1|   56|Homo sapiens ribosomal protein S29
           protein.
          Length = 56

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 32/37 (86%), Positives = 34/37 (91%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR CSNRHGLIRKYGLN+CRQCFR+YA DIGF KLD
Sbjct: 20  SCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIKLD 56



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH  +++SHPR++GQGSR
Sbjct: 1   MGHQQLYWSHPRKFGQGSR 19


>AB061847-1|BAB79485.1|   56|Homo sapiens ribosomal protein S29
           protein.
          Length = 56

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 32/37 (86%), Positives = 34/37 (91%)
 Frame = +2

Query: 140 SCRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           SCR CSNRHGLIRKYGLN+CRQCFR+YA DIGF KLD
Sbjct: 20  SCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIKLD 56



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 12/19 (63%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MGH  +++SHPR++GQGSR
Sbjct: 1   MGHQQLYWSHPRKFGQGSR 19


>AB007165-1|BAA25827.1|   26|Homo sapiens ribosomal protein S29
           protein.
          Length = 26

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = +2

Query: 167 GLIRKYGLNICRQCFREYAHDIGFKK 244
           GLIRKYGLN+CRQCFR+YA DIGF K
Sbjct: 1   GLIRKYGLNMCRQCFRQYAKDIGFIK 26


>BC047704-1|AAH47704.1|  183|Homo sapiens SPATA3 protein protein.
          Length = 183

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -1

Query: 194 CSNRTCGLSHACWSRIGM 141
           CS  TC  S ACW R+G+
Sbjct: 102 CSCATCPCSSACWRRLGL 119


>AY032925-1|AAK54455.1|  183|Homo sapiens testis and spermatogenesis
           cell apoptosis related protein 1 protein.
          Length = 183

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -1

Query: 194 CSNRTCGLSHACWSRIGM 141
           CS  TC  S ACW R+G+
Sbjct: 102 CSCATCPCSSACWRRLGL 119


>AK093385-1|BAC04149.1|  192|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36066 fis, clone TESTI2019257. ).
          Length = 192

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -1

Query: 194 CSNRTCGLSHACWSRIGM 141
           CS  TC  S ACW R+G+
Sbjct: 111 CSCATCPCSSACWRRLGL 128


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,845,349
Number of Sequences: 237096
Number of extensions: 716483
Number of successful extensions: 1592
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1564
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1592
length of database: 76,859,062
effective HSP length: 80
effective length of database: 57,891,382
effective search space used: 2026198370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -