SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z48950-1|CAA88778.1|  136|Homo sapiens histone H3.3 protein.          109   6e-24
M11354-1|AAA52653.1|  136|Homo sapiens H3F2 protein.                  109   6e-24
M11353-1|AAA52654.1|  136|Homo sapiens H3F2 protein.                  109   6e-24
BX537379-1|CAD97621.1|  136|Homo sapiens hypothetical protein pr...   109   6e-24
BC108701-1|AAI08702.1|  136|Homo sapiens H3 histone, family 3B (...   109   6e-24
BC095447-1|AAH95447.1|  136|Homo sapiens H3 histone, family 3A p...   109   6e-24
BC081561-1|AAH81561.1|  136|Homo sapiens H3 histone, family 3A p...   109   6e-24
BC081560-1|AAH81560.1|  136|Homo sapiens H3 histone, family 3A p...   109   6e-24
BC067757-1|AAH67757.1|  136|Homo sapiens H3 histone, family 3A p...   109   6e-24
BC066901-1|AAH66901.1|  136|Homo sapiens H3 histone, family 3A p...   109   6e-24
BC038989-1|AAH38989.1|  136|Homo sapiens H3 histone, family 3A p...   109   6e-24
BC029405-1|AAH29405.1|  136|Homo sapiens H3 histone, family 3A p...   109   6e-24
BC017558-1|AAH17558.1|  136|Homo sapiens H3 histone, family 3B (...   109   6e-24
BC012813-1|AAH12813.1|  136|Homo sapiens H3 histone, family 3B (...   109   6e-24
BC006497-1|AAH06497.1|  136|Homo sapiens H3 histone, family 3B (...   109   6e-24
BC001124-1|AAH01124.1|  136|Homo sapiens H3 histone, family 3B (...   109   6e-24
AL512343-2|CAH73372.1|  136|Homo sapiens H3 histone, family 3A p...   109   6e-24
AF218029-1|AAG17271.1|  136|Homo sapiens unknown protein.             109   6e-24
AY383568-1|AAQ96275.1|  107|Homo sapiens H3L-like histone protein.    109   1e-23
BC066906-1|AAH66906.1|  135|Homo sapiens similar to H3 histone, ...   106   8e-23
BC130637-1|AAI30638.1|  136|Homo sapiens histone cluster 2, H3a ...   104   2e-22
BC130635-1|AAI30636.1|  136|Homo sapiens histone cluster 2, H3a ...   104   2e-22
BC074969-1|AAH74969.2|  136|Homo sapiens histone cluster 2, H3a ...   104   2e-22
AY648851-1|AAT68254.1|  136|Homo sapiens histone H3/o protein.        104   2e-22
AL591493-14|CAI12566.1|  136|Homo sapiens histone cluster 2, H3a...   104   2e-22
AL591493-9|CAI12561.1|  136|Homo sapiens histone cluster 2, H3c ...   104   2e-22
AL591493-7|CAI12559.1|  136|Homo sapiens histone cluster 2, H3d ...   104   2e-22
AF531307-1|AAN39283.1|  136|Homo sapiens histone H3 protein.          104   2e-22
Z98744-9|CAD24076.1|  136|Homo sapiens histone 1, H3j protein.        102   1e-21
Z98744-6|CAB11424.1|  136|Homo sapiens histone 1, H3i protein.        102   1e-21
Z83737-1|CAB06032.1|  136|Homo sapiens histone H3 protein.            102   1e-21
Z83735-1|CAB06030.1|  136|Homo sapiens histone H3 protein.            102   1e-21
Z80786-1|CAB02548.1|  136|Homo sapiens histone H3 protein.            102   1e-21
Z80785-1|CAB02547.1|  136|Homo sapiens histone H3 protein.            102   1e-21
Z46261-1|CAA86403.1|  136|Homo sapiens histone H3a protein.           102   1e-21
X83550-1|CAA58540.1|  136|Homo sapiens histone H3 protein.            102   1e-21
X57128-1|CAA40407.1|  136|Homo sapiens histone H3 protein.            102   1e-21
X00090-1|CAA24952.1|  136|Homo sapiens protein ( Human histone H...   102   1e-21
M60746-1|AAA63185.1|  136|Homo sapiens histone H3.1 protein.          102   1e-21
M26150-1|AAA52651.1|  135|Homo sapiens H3F2 protein.                  102   1e-21
CR542014-1|CAG46811.1|  136|Homo sapiens HIST1H3E protein.            102   1e-21
CR542011-1|CAG46808.1|  136|Homo sapiens HIST1H3F protein.            102   1e-21
CR541983-1|CAG46780.1|  136|Homo sapiens HIST1H3F protein.            102   1e-21
CR541858-1|CAG46656.1|  136|Homo sapiens HIST1H3A protein.            102   1e-21
BC148250-1|AAI48251.1|  136|Homo sapiens HIST1H3A protein protein.    102   1e-21
BC148243-1|AAI48244.1|  136|Homo sapiens HIST1H3A protein protein.    102   1e-21
BC143046-1|AAI43047.1|  136|Homo sapiens HIST1H3A protein protein.    102   1e-21
BC127610-1|AAI27611.1|  136|Homo sapiens HIST1H3A protein protein.    102   1e-21
BC099630-1|AAH99630.1|  136|Homo sapiens histone cluster 1, H3b ...   102   1e-21
BC096134-1|AAH96134.1|  136|Homo sapiens histone cluster 1, H3b ...   102   1e-21
BC096133-1|AAH96133.1|  136|Homo sapiens histone cluster 1, H3b ...   102   1e-21
BC096132-1|AAH96132.1|  136|Homo sapiens histone cluster 1, H3b ...   102   1e-21
BC096131-1|AAH96131.1|  136|Homo sapiens histone cluster 1, H3f ...   102   1e-21
BC096130-1|AAH96130.1|  136|Homo sapiens histone cluster 1, H3h ...   102   1e-21
BC096129-1|AAH96129.1|  136|Homo sapiens histone cluster 1, H3h ...   102   1e-21
BC096128-1|AAH96128.1|  136|Homo sapiens histone cluster 1, H3h ...   102   1e-21
BC079835-1|AAH79835.1|  136|Homo sapiens histone cluster 1, H3g ...   102   1e-21
BC069818-1|AAH69818.1|  136|Homo sapiens histone cluster 1, H3f ...   102   1e-21
BC069305-1|AAH69305.2|  136|Homo sapiens histone cluster 1, H3i ...   102   1e-21
BC069303-1|AAH69303.1|  136|Homo sapiens histone cluster 1, H3a ...   102   1e-21
BC069133-1|AAH69133.1|  136|Homo sapiens histone cluster 1, H3b ...   102   1e-21
BC067494-1|AAH67494.1|  137|Homo sapiens HIST1H3I protein protein.    102   1e-21
BC067492-1|AAH67492.1|  136|Homo sapiens histone cluster 1, H3f ...   102   1e-21
BC067491-1|AAH67491.1|  136|Homo sapiens histone cluster 1, H3a ...   102   1e-21
BC067490-1|AAH67490.1|  136|Homo sapiens histone cluster 1, H3a ...   102   1e-21
BC066884-1|AAH66884.1|  136|Homo sapiens histone cluster 1, H3i ...   102   1e-21
BC066247-1|AAH66247.1|  136|Homo sapiens histone cluster 1, H3a ...   102   1e-21
BC066246-1|AAH66246.1|  136|Homo sapiens histone cluster 1, H3a ...   102   1e-21
BC066245-1|AAH66245.1|  136|Homo sapiens histone cluster 1, H3a ...   102   1e-21
BC052981-1|AAH52981.1|  136|Homo sapiens histone cluster 1, H3e ...   102   1e-21
BC033095-1|AAH33095.1|  136|Homo sapiens histone cluster 1, H3d ...   102   1e-21
BC031333-1|AAH31333.1|  136|Homo sapiens histone cluster 1, H3d ...   102   1e-21
BC012185-1|AAH12185.1|  136|Homo sapiens histone cluster 1, H3g ...   102   1e-21
BC007518-1|AAH07518.1|  136|Homo sapiens histone cluster 1, H3h ...   102   1e-21
AL031777-16|CAC03421.1|  136|Homo sapiens histone 1, H3g protein.     102   1e-21
AL031777-14|CAC03416.1|  136|Homo sapiens histone 1, H3f protein.     102   1e-21
AL031777-9|CAC03413.1|  136|Homo sapiens histone 1, H3e protein.      102   1e-21
AL031777-2|CAC03412.1|  136|Homo sapiens histone 1, H3d protein.      102   1e-21
AL009179-6|CAA15670.1|  136|Homo sapiens histone 1, H3h protein.      102   1e-21
AF531283-1|AAN10060.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531282-1|AAN10059.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531281-1|AAN10058.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531280-1|AAN10057.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531279-1|AAN10056.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531278-1|AAN10055.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531277-1|AAN10054.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531276-1|AAN10053.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531275-1|AAN10052.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AF531274-1|AAN10051.1|  136|Homo sapiens histone H3 protein.          102   1e-21
AL109948-2|CAI23568.1|  136|Homo sapiens histone cluster 2, H3, ...   101   3e-21
Z49861-1|CAA90020.1|  136|Homo sapiens histone H3 protein.            100   5e-21
CR542013-1|CAG46810.1|  136|Homo sapiens HIST3H3 protein.             100   5e-21
BC101839-1|AAI01840.1|  136|Homo sapiens histone cluster 3, H3 p...   100   5e-21
BC101837-1|AAI01838.1|  136|Homo sapiens histone cluster 3, H3 p...   100   5e-21
BC069079-1|AAH69079.1|  136|Homo sapiens histone cluster 3, H3 p...   100   5e-21
AL139288-6|CAI23333.1|  136|Homo sapiens histone cluster 3, H3 p...   100   5e-21
AF531308-1|AAN39284.1|  136|Homo sapiens histone H3 protein.          100   5e-21
BC067493-1|AAH67493.1|  136|Homo sapiens histone cluster 1, H3i ...   100   9e-21
Z80784-1|CAB02546.1|  136|Homo sapiens histone H3 protein.             99   1e-20
AL512343-1|CAH73371.1|  123|Homo sapiens H3 histone, family 3A p...    97   5e-20
X05855-1|CAA29288.1|   60|Homo sapiens histone H3.3 protein.           96   8e-20
U14518-1|AAA57416.1|  140|Homo sapiens centromere protein-A prot...    62   2e-09
BT007246-1|AAP35910.1|  140|Homo sapiens centromere protein A, 1...    62   2e-09
BC002703-1|AAH02703.1|  140|Homo sapiens CENPA protein protein.        62   2e-09
AC011740-3|AAX93267.1|  140|Homo sapiens unknown protein.              62   2e-09
V00521-1|CAA23780.1|   27|Homo sapiens protein ( Human gene frag...    57   6e-08
BC011013-1|AAH11013.1|  127|Homo sapiens CENPA protein protein.        48   3e-05
BC000881-1|AAH00881.1|  114|Homo sapiens centromere protein A pr...    48   3e-05
X74331-1|CAA52378.1|  509|Homo sapiens DNA primase (p58 subunit)...    33   0.67 
X53655-1|CAA37703.1|  257|Homo sapiens nerve growth factor protein.    33   0.67 
M61180-1|AAA63231.1|  257|Homo sapiens neurotrophin-3 protein.         33   0.67 
M37763-1|AAA59953.1|  257|Homo sapiens neurotrophin-3 protein.         33   0.67 
CR541906-1|CAG46704.1|  257|Homo sapiens NTF3 protein.                 33   0.67 
BC107075-1|AAI07076.1|  257|Homo sapiens neurotrophin 3 protein.       33   0.67 
BC069773-1|AAH69773.1|  257|Homo sapiens neurotrophin 3 protein.       33   0.67 
BC064931-1|AAH64931.1|  509|Homo sapiens primase, DNA, polypepti...    33   0.89 
AM177180-1|CAJ45484.1| 1670|Homo sapiens kinesin-like protein KI...    33   0.89 
AL162579-2|CAI40673.1|  340|Homo sapiens primase, polypeptide 2A...    33   0.89 
AL121975-2|CAI42767.1|  340|Homo sapiens primase, polypeptide 2A...    33   0.89 
AL121958-1|CAC03545.2|  340|Homo sapiens primase, polypeptide 2A...    33   0.89 
AB007918-1|BAA32294.2| 1628|Homo sapiens KIAA0449 protein protein.     33   0.89 
BC017833-1|AAH17833.1|  158|Homo sapiens PRIM2A protein protein.       33   1.2  
AL162579-1|CAH73686.1|  158|Homo sapiens primase, polypeptide 2A...    33   1.2  
AL121975-1|CAI20534.1|  158|Homo sapiens primase, polypeptide 2A...    33   1.2  
BC006137-1|AAH06137.1|  960|Homo sapiens RBM19 protein protein.        31   4.7  
BC004289-1|AAH04289.1|  960|Homo sapiens RBM19 protein protein.        31   4.7  
AB014582-1|BAA31657.2|  973|Homo sapiens KIAA0682 protein protein.     31   4.7  
AF301482-1|AAG30428.1|   98|Homo sapiens anticardiolipin immunog...    30   8.3  

>Z48950-1|CAA88778.1|  136|Homo sapiens histone H3.3 protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>M11354-1|AAA52653.1|  136|Homo sapiens H3F2 protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>M11353-1|AAA52654.1|  136|Homo sapiens H3F2 protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BX537379-1|CAD97621.1|  136|Homo sapiens hypothetical protein
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC108701-1|AAI08702.1|  136|Homo sapiens H3 histone, family 3B
           (H3.3B) protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC095447-1|AAH95447.1|  136|Homo sapiens H3 histone, family 3A
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC081561-1|AAH81561.1|  136|Homo sapiens H3 histone, family 3A
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 44/45 (97%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTA KSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTALKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC081560-1|AAH81560.1|  136|Homo sapiens H3 histone, family 3A
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC067757-1|AAH67757.1|  136|Homo sapiens H3 histone, family 3A
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC066901-1|AAH66901.1|  136|Homo sapiens H3 histone, family 3A
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC038989-1|AAH38989.1|  136|Homo sapiens H3 histone, family 3A
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC029405-1|AAH29405.1|  136|Homo sapiens H3 histone, family 3A
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC017558-1|AAH17558.1|  136|Homo sapiens H3 histone, family 3B
           (H3.3B) protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC012813-1|AAH12813.1|  136|Homo sapiens H3 histone, family 3B
           (H3.3B) protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC006497-1|AAH06497.1|  136|Homo sapiens H3 histone, family 3B
           (H3.3B) protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC001124-1|AAH01124.1|  136|Homo sapiens H3 histone, family 3B
           (H3.3B) protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL512343-2|CAH73372.1|  136|Homo sapiens H3 histone, family 3A
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF218029-1|AAG17271.1|  136|Homo sapiens unknown protein.
          Length = 136

 Score =  109 bits (263), Expect = 6e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AY383568-1|AAQ96275.1|  107|Homo sapiens H3L-like histone protein.
          Length = 107

 Score =  109 bits (261), Expect = 1e-23
 Identities = 54/56 (96%), Positives = 55/56 (98%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYL 426
           TVALREIRRYQKSTELL+RKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL
Sbjct: 31  TVALREIRRYQKSTELLVRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYL 86



 Score = 67.3 bits (157), Expect = 4e-11
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = +3

Query: 168 APRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           APRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   APRKQLATKAARKSAPSTGGVKKPHRYRPG 30



 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMP 490
           LFEDTNLCAIHAKRVTIMP
Sbjct: 89  LFEDTNLCAIHAKRVTIMP 107


>BC066906-1|AAH66906.1|  135|Homo sapiens similar to H3 histone,
           family 3B protein.
          Length = 135

 Score =  106 bits (254), Expect = 8e-23
 Identities = 53/60 (88%), Positives = 55/60 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLV 438
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDF TDL FQSA +GALQEASEAYL  L+
Sbjct: 45  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFNTDLRFQSAVVGALQEASEAYLVGLL 104



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 42/45 (93%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKS PST GV KPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGV-KPHRYRPG 44



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GL EDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 102 GLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 135


>BC130637-1|AAI30638.1|  136|Homo sapiens histone cluster 2, H3a
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 2e-22
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC130635-1|AAI30636.1|  136|Homo sapiens histone cluster 2, H3a
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 2e-22
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC074969-1|AAH74969.2|  136|Homo sapiens histone cluster 2, H3a
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 2e-22
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AY648851-1|AAT68254.1|  136|Homo sapiens histone H3/o protein.
          Length = 136

 Score =  104 bits (250), Expect = 2e-22
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL591493-14|CAI12566.1|  136|Homo sapiens histone cluster 2, H3a
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 2e-22
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL591493-9|CAI12561.1|  136|Homo sapiens histone cluster 2, H3c
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 2e-22
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL591493-7|CAI12559.1|  136|Homo sapiens histone cluster 2, H3d
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 2e-22
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531307-1|AAN39283.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  104 bits (250), Expect = 2e-22
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z98744-9|CAD24076.1|  136|Homo sapiens histone 1, H3j protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z98744-6|CAB11424.1|  136|Homo sapiens histone 1, H3i protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z83737-1|CAB06032.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z83735-1|CAB06030.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z80786-1|CAB02548.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z80785-1|CAB02547.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z46261-1|CAA86403.1|  136|Homo sapiens histone H3a protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>X83550-1|CAA58540.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>X57128-1|CAA40407.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>X00090-1|CAA24952.1|  136|Homo sapiens protein ( Human histone H3
           gene. ).
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>M60746-1|AAA63185.1|  136|Homo sapiens histone H3.1 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>M26150-1|AAA52651.1|  135|Homo sapiens H3F2 protein.
          Length = 135

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 32/32 (100%), Positives = 32/32 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 526
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 134


>CR542014-1|CAG46811.1|  136|Homo sapiens HIST1H3E protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>CR542011-1|CAG46808.1|  136|Homo sapiens HIST1H3F protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>CR541983-1|CAG46780.1|  136|Homo sapiens HIST1H3F protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>CR541858-1|CAG46656.1|  136|Homo sapiens HIST1H3A protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC148250-1|AAI48251.1|  136|Homo sapiens HIST1H3A protein protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC148243-1|AAI48244.1|  136|Homo sapiens HIST1H3A protein protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC143046-1|AAI43047.1|  136|Homo sapiens HIST1H3A protein protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC127610-1|AAI27611.1|  136|Homo sapiens HIST1H3A protein protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC099630-1|AAH99630.1|  136|Homo sapiens histone cluster 1, H3b
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC096134-1|AAH96134.1|  136|Homo sapiens histone cluster 1, H3b
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC096133-1|AAH96133.1|  136|Homo sapiens histone cluster 1, H3b
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC096132-1|AAH96132.1|  136|Homo sapiens histone cluster 1, H3b
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC096131-1|AAH96131.1|  136|Homo sapiens histone cluster 1, H3f
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC096130-1|AAH96130.1|  136|Homo sapiens histone cluster 1, H3h
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC096129-1|AAH96129.1|  136|Homo sapiens histone cluster 1, H3h
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC096128-1|AAH96128.1|  136|Homo sapiens histone cluster 1, H3h
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC079835-1|AAH79835.1|  136|Homo sapiens histone cluster 1, H3g
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC069818-1|AAH69818.1|  136|Homo sapiens histone cluster 1, H3f
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC069305-1|AAH69305.2|  136|Homo sapiens histone cluster 1, H3i
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC069303-1|AAH69303.1|  136|Homo sapiens histone cluster 1, H3a
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC069133-1|AAH69133.1|  136|Homo sapiens histone cluster 1, H3b
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC067494-1|AAH67494.1|  137|Homo sapiens HIST1H3I protein protein.
          Length = 137

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 47  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 105



 Score = 92.3 bits (219), Expect = 1e-18
 Identities = 42/43 (97%), Positives = 43/43 (100%)
 Frame = +3

Query: 129 RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           RTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 4   RTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 46



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 104 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 137


>BC067492-1|AAH67492.1|  136|Homo sapiens histone cluster 1, H3f
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC067491-1|AAH67491.1|  136|Homo sapiens histone cluster 1, H3a
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC067490-1|AAH67490.1|  136|Homo sapiens histone cluster 1, H3a
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC066884-1|AAH66884.1|  136|Homo sapiens histone cluster 1, H3i
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 69.7 bits (163), Expect = 8e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIM KDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMLKDIQLARRIRGERA 136


>BC066247-1|AAH66247.1|  136|Homo sapiens histone cluster 1, H3a
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC066246-1|AAH66246.1|  136|Homo sapiens histone cluster 1, H3a
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC066245-1|AAH66245.1|  136|Homo sapiens histone cluster 1, H3a
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC052981-1|AAH52981.1|  136|Homo sapiens histone cluster 1, H3e
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC033095-1|AAH33095.1|  136|Homo sapiens histone cluster 1, H3d
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC031333-1|AAH31333.1|  136|Homo sapiens histone cluster 1, H3d
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC012185-1|AAH12185.1|  136|Homo sapiens histone cluster 1, H3g
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>BC007518-1|AAH07518.1|  136|Homo sapiens histone cluster 1, H3h
           protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL031777-16|CAC03421.1|  136|Homo sapiens histone 1, H3g protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL031777-14|CAC03416.1|  136|Homo sapiens histone 1, H3f protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL031777-9|CAC03413.1|  136|Homo sapiens histone 1, H3e protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL031777-2|CAC03412.1|  136|Homo sapiens histone 1, H3d protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL009179-6|CAA15670.1|  136|Homo sapiens histone 1, H3h protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531283-1|AAN10060.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531282-1|AAN10059.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531281-1|AAN10058.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531280-1|AAN10057.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531279-1|AAN10056.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531278-1|AAN10055.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531277-1|AAN10054.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531276-1|AAN10053.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531275-1|AAN10052.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AF531274-1|AAN10051.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  102 bits (245), Expect = 1e-21
 Identities = 52/59 (88%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL109948-2|CAI23568.1|  136|Homo sapiens histone cluster 2, H3,
           pseudogene 2 protein.
          Length = 136

 Score =  101 bits (241), Expect = 3e-21
 Identities = 51/59 (86%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQ+FKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQEFKTDLRFQSSAVMALQEAREAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 69.7 bits (163), Expect = 8e-12
 Identities = 32/34 (94%), Positives = 32/34 (94%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQL  RIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLVSRIRGERA 136


>Z49861-1|CAA90020.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  100 bits (239), Expect = 5e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRL+REIAQDFKTDL FQS+A+ ALQEA E+YL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGL 104



 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATK ARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPG 45



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLC IHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA 136


>CR542013-1|CAG46810.1|  136|Homo sapiens HIST3H3 protein.
          Length = 136

 Score =  100 bits (239), Expect = 5e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRL+REIAQDFKTDL FQS+A+ ALQEA E+YL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGL 104



 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATK ARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPG 45



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLC IHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA 136


>BC101839-1|AAI01840.1|  136|Homo sapiens histone cluster 3, H3
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 5e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRL+REIAQDFKTDL FQS+A+ ALQEA E+YL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGL 104



 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATK ARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPG 45



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLC IHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA 136


>BC101837-1|AAI01838.1|  136|Homo sapiens histone cluster 3, H3
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 5e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRL+REIAQDFKTDL FQS+A+ ALQEA E+YL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGL 104



 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATK ARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPG 45



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLC IHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA 136


>BC069079-1|AAH69079.1|  136|Homo sapiens histone cluster 3, H3
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 5e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRL+REIAQDFKTDL FQS+A+ ALQEA E+YL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGL 104



 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATK ARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPG 45



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLC IHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA 136


>AL139288-6|CAI23333.1|  136|Homo sapiens histone cluster 3, H3
           protein.
          Length = 136

 Score =  100 bits (239), Expect = 5e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRL+REIAQDFKTDL FQS+A+ ALQEA E+YL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGL 104



 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATK ARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPG 45



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLC IHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA 136


>AF531308-1|AAN39284.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score =  100 bits (239), Expect = 5e-21
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRL+REIAQDFKTDL FQS+A+ ALQEA E+YL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGL 104



 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATK ARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPG 45



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 33/34 (97%), Positives = 33/34 (97%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLC IHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA 136


>BC067493-1|AAH67493.1|  136|Homo sapiens histone cluster 1, H3i
           protein.
          Length = 136

 Score = 99.5 bits (237), Expect = 9e-21
 Identities = 51/59 (86%), Positives = 53/59 (89%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQ LVREIAQDFKTDL FQS+A+ ALQEA EAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQCLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>Z80784-1|CAB02546.1|  136|Homo sapiens histone H3 protein.
          Length = 136

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 51/59 (86%), Positives = 53/59 (89%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEA EA L  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEATLVGL 104



 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AL512343-1|CAH73371.1|  123|Homo sapiens H3 histone, family 3A
           protein.
          Length = 123

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 96.3 bits (229), Expect = 8e-20
 Identities = 48/49 (97%), Positives = 48/49 (97%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQ 405
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQ
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQ 94


>X05855-1|CAA29288.1|   60|Homo sapiens histone H3.3 protein.
          Length = 60

 Score = 96.3 bits (229), Expect = 8e-20
 Identities = 48/49 (97%), Positives = 48/49 (97%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQ 405
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQ
Sbjct: 12  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQ 60


>U14518-1|AAA57416.1|  140|Homo sapiens centromere protein-A
           protein.
          Length = 140

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYLXWL 435
           L+EIR+ QKST LLIRKLPF RL REI   F    D  +Q+ A+ ALQEA+EA+L  L
Sbjct: 48  LKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHL 105



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 105 LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 134


>BT007246-1|AAP35910.1|  140|Homo sapiens centromere protein A,
           17kDa protein.
          Length = 140

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYLXWL 435
           L+EIR+ QKST LLIRKLPF RL REI   F    D  +Q+ A+ ALQEA+EA+L  L
Sbjct: 48  LKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHL 105



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 105 LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 134


>BC002703-1|AAH02703.1|  140|Homo sapiens CENPA protein protein.
          Length = 140

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYLXWL 435
           L+EIR+ QKST LLIRKLPF RL REI   F    D  +Q+ A+ ALQEA+EA+L  L
Sbjct: 48  LKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHL 105



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 105 LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 134


>AC011740-3|AAX93267.1|  140|Homo sapiens unknown protein.
          Length = 140

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVREIAQDFK--TDLXFQSAAIGALQEASEAYLXWL 435
           L+EIR+ QKST LLIRKLPF RL REI   F    D  +Q+ A+ ALQEA+EA+L  L
Sbjct: 48  LKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHL 105



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 105 LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 134


>V00521-1|CAA23780.1|   27|Homo sapiens protein ( Human gene
           fragment for histone H3 (germline gene). ).
          Length = 27

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 27/27 (100%), Positives = 27/27 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAAR 203
           MARTKQTARKSTGGKAPRKQLATKAAR
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAAR 27


>BC011013-1|AAH11013.1|  127|Homo sapiens CENPA protein protein.
          Length = 127

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 92  LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 121



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 19/26 (73%), Positives = 21/26 (80%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVRE 345
           L+EIR+ QKST LLIRKLPF RL  E
Sbjct: 61  LKEIRKLQKSTHLLIRKLPFSRLAAE 86


>BC000881-1|AAH00881.1|  114|Homo sapiens centromere protein A
           protein.
          Length = 114

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 21/30 (70%), Positives = 24/30 (80%)
 Frame = +2

Query: 434 LFEDTNLCAIHAKRVTIMPKDIQLARRIRG 523
           LFED  L  +HA RVT+ PKD+QLARRIRG
Sbjct: 79  LFEDAYLLTLHAGRVTLFPKDVQLARRIRG 108



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 19/26 (73%), Positives = 21/26 (80%)
 Frame = +1

Query: 268 LREIRRYQKSTELLIRKLPFQRLVRE 345
           L+EIR+ QKST LLIRKLPF RL  E
Sbjct: 48  LKEIRKLQKSTHLLIRKLPFSRLAAE 73


>X74331-1|CAA52378.1|  509|Homo sapiens DNA primase (p58 subunit)
           protein.
          Length = 509

 Score = 33.5 bits (73), Expect = 0.67
 Identities = 24/86 (27%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYREKLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  AI
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAI 154


>X53655-1|CAA37703.1|  257|Homo sapiens nerve growth factor protein.
          Length = 257

 Score = 33.5 bits (73), Expect = 0.67
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +1

Query: 127 LVLNKLPVNLLEVKLRVNNLLQKR---RENQRRALVESRSHIVIALXTVALREIRRYQKS 297
           ++ NKL   +++VK    + L K    RE +R    +S    VIA+ T  LR+ RRY   
Sbjct: 43  ILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSP 102

Query: 298 TELLIRKLPFQRLVREIAQDF 360
             LL    P +     + +D+
Sbjct: 103 RVLLSDSTPLEPPPLYLMEDY 123


>M61180-1|AAA63231.1|  257|Homo sapiens neurotrophin-3 protein.
          Length = 257

 Score = 33.5 bits (73), Expect = 0.67
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +1

Query: 127 LVLNKLPVNLLEVKLRVNNLLQKR---RENQRRALVESRSHIVIALXTVALREIRRYQKS 297
           ++ NKL   +++VK    + L K    RE +R    +S    VIA+ T  LR+ RRY   
Sbjct: 43  ILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSP 102

Query: 298 TELLIRKLPFQRLVREIAQDF 360
             LL    P +     + +D+
Sbjct: 103 RVLLSDSTPLEPPPLYLMEDY 123


>M37763-1|AAA59953.1|  257|Homo sapiens neurotrophin-3 protein.
          Length = 257

 Score = 33.5 bits (73), Expect = 0.67
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +1

Query: 127 LVLNKLPVNLLEVKLRVNNLLQKR---RENQRRALVESRSHIVIALXTVALREIRRYQKS 297
           ++ NKL   +++VK    + L K    RE +R    +S    VIA+ T  LR+ RRY   
Sbjct: 43  ILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSP 102

Query: 298 TELLIRKLPFQRLVREIAQDF 360
             LL    P +     + +D+
Sbjct: 103 RVLLSDSTPLEPPPLYLMEDY 123


>CR541906-1|CAG46704.1|  257|Homo sapiens NTF3 protein.
          Length = 257

 Score = 33.5 bits (73), Expect = 0.67
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +1

Query: 127 LVLNKLPVNLLEVKLRVNNLLQKR---RENQRRALVESRSHIVIALXTVALREIRRYQKS 297
           ++ NKL   +++VK    + L K    RE +R    +S    VIA+ T  LR+ RRY   
Sbjct: 43  ILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSP 102

Query: 298 TELLIRKLPFQRLVREIAQDF 360
             LL    P +     + +D+
Sbjct: 103 RVLLSDSTPLEPPPLYLMEDY 123


>BC107075-1|AAI07076.1|  257|Homo sapiens neurotrophin 3 protein.
          Length = 257

 Score = 33.5 bits (73), Expect = 0.67
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +1

Query: 127 LVLNKLPVNLLEVKLRVNNLLQKR---RENQRRALVESRSHIVIALXTVALREIRRYQKS 297
           ++ NKL   +++VK    + L K    RE +R    +S    VIA+ T  LR+ RRY   
Sbjct: 43  ILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSP 102

Query: 298 TELLIRKLPFQRLVREIAQDF 360
             LL    P +     + +D+
Sbjct: 103 RVLLSDSTPLEPPPLYLMEDY 123


>BC069773-1|AAH69773.1|  257|Homo sapiens neurotrophin 3 protein.
          Length = 257

 Score = 33.5 bits (73), Expect = 0.67
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +1

Query: 127 LVLNKLPVNLLEVKLRVNNLLQKR---RENQRRALVESRSHIVIALXTVALREIRRYQKS 297
           ++ NKL   +++VK    + L K    RE +R    +S    VIA+ T  LR+ RRY   
Sbjct: 43  ILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDTELLRQQRRYNSP 102

Query: 298 TELLIRKLPFQRLVREIAQDF 360
             LL    P +     + +D+
Sbjct: 103 RVLLSDSTPLEPPPLYLMEDY 123


>BC064931-1|AAH64931.1|  509|Homo sapiens primase, DNA, polypeptide
           2 (58kDa) protein.
          Length = 509

 Score = 33.1 bits (72), Expect = 0.89
 Identities = 24/86 (27%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYRENLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  AI
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAI 154


>AM177180-1|CAJ45484.1| 1670|Homo sapiens kinesin-like protein
           KIF21B variant protein.
          Length = 1670

 Score = 33.1 bits (72), Expect = 0.89
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +1

Query: 133 LNKLPVNLLEVK-LRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELL 309
           L KL   + E+K  +V  + Q R E QRR LVE++ +  IA       ++++ Q+  E  
Sbjct: 745 LKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKRNREIA-------QLKKEQRRQEFQ 797

Query: 310 IRKLPFQRLVREIAQDFKT 366
           IR L  Q+  +E+    KT
Sbjct: 798 IRALESQKRQQEMVLRRKT 816


>AL162579-2|CAI40673.1|  340|Homo sapiens primase, polypeptide 2A,
           58kDa protein.
          Length = 340

 Score = 33.1 bits (72), Expect = 0.89
 Identities = 24/86 (27%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYRENLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  AI
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAI 154


>AL121975-2|CAI42767.1|  340|Homo sapiens primase, polypeptide 2A,
           58kDa protein.
          Length = 340

 Score = 33.1 bits (72), Expect = 0.89
 Identities = 24/86 (27%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYRENLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  AI
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAI 154


>AL121958-1|CAC03545.2|  340|Homo sapiens primase, polypeptide 2A,
           58kDa protein.
          Length = 340

 Score = 33.1 bits (72), Expect = 0.89
 Identities = 24/86 (27%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYRENLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  AI
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAI 154


>AB007918-1|BAA32294.2| 1628|Homo sapiens KIAA0449 protein protein.
          Length = 1628

 Score = 33.1 bits (72), Expect = 0.89
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +1

Query: 133 LNKLPVNLLEVK-LRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELL 309
           L KL   + E+K  +V  + Q R E QRR LVE++ +  IA       ++++ Q+  E  
Sbjct: 749 LKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKRNREIA-------QLKKEQRRQEFQ 801

Query: 310 IRKLPFQRLVREIAQDFKT 366
           IR L  Q+  +E+    KT
Sbjct: 802 IRALESQKRQQEMVLRRKT 820


>BC017833-1|AAH17833.1|  158|Homo sapiens PRIM2A protein protein.
          Length = 158

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYRENLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  A+
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAV 154


>AL162579-1|CAH73686.1|  158|Homo sapiens primase, polypeptide 2A,
           58kDa protein.
          Length = 158

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYRENLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  A+
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAV 154


>AL121975-1|CAI20534.1|  158|Homo sapiens primase, polypeptide 2A,
           58kDa protein.
          Length = 158

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +1

Query: 136 NKLPVNLLEVKLRVNNLLQKRRENQRRALVESRSHIVIALXTVALREIRRYQKSTELLIR 315
           +KL   L ++K      L+   E +RR  +   SH ++ L      E+RR+    E+ + 
Sbjct: 72  SKLESELRKLKFSYRENLEDEYEPRRRDHI---SHFILRLAYCQSEELRRWFIQQEMDLL 128

Query: 316 KLPFQRLVREIAQDFKTDLXFQSAAI 393
           +  F  L ++  QDF  D   Q  A+
Sbjct: 129 RFRFSILPKDKIQDFLKDSQLQFEAV 154


>BC006137-1|AAH06137.1|  960|Homo sapiens RBM19 protein protein.
          Length = 960

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +1

Query: 250 ALXTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT 366
           A+     +++ R Q ++++L+R +PFQ   REI + F T
Sbjct: 816 AVTLARKKQVPRKQTTSKILVRNIPFQAHSREIRELFST 854


>BC004289-1|AAH04289.1|  960|Homo sapiens RBM19 protein protein.
          Length = 960

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +1

Query: 250 ALXTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT 366
           A+     +++ R Q ++++L+R +PFQ   REI + F T
Sbjct: 816 AVTLARKKQVPRKQTTSKILVRNIPFQAHSREIRELFST 854


>AB014582-1|BAA31657.2|  973|Homo sapiens KIAA0682 protein protein.
          Length = 973

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +1

Query: 250 ALXTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT 366
           A+     +++ R Q ++++L+R +PFQ   REI + F T
Sbjct: 829 AVTLARKKQVPRKQTTSKILVRNIPFQAHSREIRELFST 867


>AF301482-1|AAG30428.1|   98|Homo sapiens anticardiolipin
           immunoglobulin heavy chain protein.
          Length = 98

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = +2

Query: 182 TCYKSGAKISAEHWWSQEATSLSPWXQW 265
           TC  SG  I++ HWWS    S     +W
Sbjct: 21  TCAVSGGSITSRHWWSWVRQSPGKGLEW 48


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,568,744
Number of Sequences: 237096
Number of extensions: 1380009
Number of successful extensions: 3310
Number of sequences better than 10.0: 128
Number of HSP's better than 10.0 without gapping: 3047
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3305
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7310122300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -