SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M81757-1|AAA89070.1|  145|Homo sapiens S19 ribosomal protein pro...   125   8e-29
BC018616-1|AAH18616.1|  145|Homo sapiens ribosomal protein S19 p...   125   8e-29
BC017386-1|AAH17386.1|  157|Homo sapiens ribosomal protein S19 p...   125   8e-29
BC007615-1|AAH07615.1|  145|Homo sapiens ribosomal protein S19 p...   125   8e-29
BC000023-1|AAH00023.1|  145|Homo sapiens ribosomal protein S19 p...   125   8e-29
AF092907-1|AAD13668.1|  145|Homo sapiens ribosomal protein S19 p...   125   8e-29
AB007155-1|BAA28593.1|   18|Homo sapiens ribosomal protein S19 p...    31   2.5  
Z97055-5|CAB09789.1|  429|Homo sapiens protein ( Human DNA seque...    30   4.4  
BC104843-1|AAI04844.1|  429|Homo sapiens patatin-like phospholip...    30   4.4  
BC104839-1|AAI04840.1|  429|Homo sapiens patatin-like phospholip...    30   4.4  
BC031820-1|AAH31820.1|  429|Homo sapiens patatin-like phospholip...    30   4.4  
AL691452-3|CAI16725.1| 2039|Homo sapiens complement component (3...    30   5.8  
AL691452-2|CAI16723.1| 2039|Homo sapiens complement component (3...    30   5.8  
AL691452-1|CAI16724.1| 2039|Homo sapiens complement component (3...    30   5.8  
AL137789-3|CAI16043.1| 2039|Homo sapiens complement component (3...    30   5.8  
AL137789-2|CAI16042.1| 2039|Homo sapiens complement component (3...    30   5.8  
AL137789-1|CAI16044.1| 2039|Homo sapiens complement component (3...    30   5.8  
AF264715-1|AAG14442.1|  132|Homo sapiens complement receptor typ...    30   5.8  
AB209470-1|BAD92707.1|  249|Homo sapiens proteasome beta 2 subun...    30   5.8  
AY701504-1|AAV65577.1|  116|Homo sapiens CR1 protein domain SCR2...    29   7.6  

>M81757-1|AAA89070.1|  145|Homo sapiens S19 ribosomal protein
           protein.
          Length = 145

 Score =  125 bits (302), Expect = 8e-29
 Identities = 57/87 (65%), Positives = 69/87 (79%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A+  RH+Y+R   GV ++TKI+GGR+RNGV PSHF R S S+AR+ LQ+LE LK
Sbjct: 52  WFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLK 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VEK QDGGR LT QG+RDLDRIA QV
Sbjct: 112 MVEKDQDGGRKLTPQGQRDLDRIAGQV 138



 Score = 66.1 bits (154), Expect = 7e-11
 Identities = 31/49 (63%), Positives = 38/49 (77%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           M  VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAPYD
Sbjct: 1   MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYD 49


>BC018616-1|AAH18616.1|  145|Homo sapiens ribosomal protein S19
           protein.
          Length = 145

 Score =  125 bits (302), Expect = 8e-29
 Identities = 57/87 (65%), Positives = 69/87 (79%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A+  RH+Y+R   GV ++TKI+GGR+RNGV PSHF R S S+AR+ LQ+LE LK
Sbjct: 52  WFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLK 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VEK QDGGR LT QG+RDLDRIA QV
Sbjct: 112 MVEKDQDGGRKLTPQGQRDLDRIAGQV 138



 Score = 66.1 bits (154), Expect = 7e-11
 Identities = 31/49 (63%), Positives = 38/49 (77%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           M  VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAPYD
Sbjct: 1   MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYD 49


>BC017386-1|AAH17386.1|  157|Homo sapiens ribosomal protein S19
           protein.
          Length = 157

 Score =  125 bits (302), Expect = 8e-29
 Identities = 57/87 (65%), Positives = 69/87 (79%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A+  RH+Y+R   GV ++TKI+GGR+RNGV PSHF R S S+AR+ LQ+LE LK
Sbjct: 64  WFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLK 123

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VEK QDGGR LT QG+RDLDRIA QV
Sbjct: 124 MVEKDQDGGRKLTPQGQRDLDRIAGQV 150



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 30/46 (65%), Positives = 37/46 (80%)
 Frame = +2

Query: 44  VTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAPYD
Sbjct: 16  VTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYD 61


>BC007615-1|AAH07615.1|  145|Homo sapiens ribosomal protein S19
           protein.
          Length = 145

 Score =  125 bits (302), Expect = 8e-29
 Identities = 57/87 (65%), Positives = 69/87 (79%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A+  RH+Y+R   GV ++TKI+GGR+RNGV PSHF R S S+AR+ LQ+LE LK
Sbjct: 52  WFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLK 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VEK QDGGR LT QG+RDLDRIA QV
Sbjct: 112 MVEKDQDGGRKLTPQGQRDLDRIAGQV 138



 Score = 66.1 bits (154), Expect = 7e-11
 Identities = 31/49 (63%), Positives = 38/49 (77%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           M  VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAPYD
Sbjct: 1   MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYD 49


>BC000023-1|AAH00023.1|  145|Homo sapiens ribosomal protein S19
           protein.
          Length = 145

 Score =  125 bits (302), Expect = 8e-29
 Identities = 57/87 (65%), Positives = 69/87 (79%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A+  RH+Y+R   GV ++TKI+GGR+RNGV PSHF R S S+AR+ LQ+LE LK
Sbjct: 52  WFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLK 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VEK QDGGR LT QG+RDLDRIA QV
Sbjct: 112 MVEKDQDGGRKLTPQGQRDLDRIAGQV 138



 Score = 66.1 bits (154), Expect = 7e-11
 Identities = 31/49 (63%), Positives = 38/49 (77%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           M  VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAPYD
Sbjct: 1   MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYD 49


>AF092907-1|AAD13668.1|  145|Homo sapiens ribosomal protein S19
           protein.
          Length = 145

 Score =  125 bits (302), Expect = 8e-29
 Identities = 57/87 (65%), Positives = 69/87 (79%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY R A+  RH+Y+R   GV ++TKI+GGR+RNGV PSHF R S S+AR+ LQ+LE LK
Sbjct: 52  WFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQALEGLK 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VEK QDGGR LT QG+RDLDRIA QV
Sbjct: 112 MVEKDQDGGRKLTPQGQRDLDRIAGQV 138



 Score = 66.1 bits (154), Expect = 7e-11
 Identities = 31/49 (63%), Positives = 38/49 (77%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           M  VTVKDV Q + V+ +AA LKK+GK+KVPE +D VK A+ KELAPYD
Sbjct: 1   MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYD 49


>AB007155-1|BAA28593.1|   18|Homo sapiens ribosomal protein S19
           protein.
          Length = 18

 Score = 31.1 bits (67), Expect = 2.5
 Identities = 14/18 (77%), Positives = 15/18 (83%)
 Frame = +3

Query: 393 GRILTTQGRRDLDRIAAQ 446
           GR LT QG+RDLDRIA Q
Sbjct: 1   GRKLTPQGQRDLDRIAGQ 18


>Z97055-5|CAB09789.1|  429|Homo sapiens protein ( Human DNA sequence
           from clone RP3-388M5 on chromosome 22. ).
          Length = 429

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 5/89 (5%)
 Frame = +2

Query: 32  KMRSVTVKDVEQ-DKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPXLVLCALC 208
           K+  V VKDV   +++   + A LKK          D  + ARF    P      L   C
Sbjct: 295 KVPHVQVKDVPNFEQLSPELEAALKKACT------RDPSRWARFWHSGPGQVLTYLLLPC 348

Query: 209 CHPSSYLH----SLTCWSKDCHQDLWWAQ 283
             P  Y++     L  W  D   DLWW Q
Sbjct: 349 TLPFEYIYFRSRRLVVWLPDVPADLWWMQ 377


>BC104843-1|AAI04844.1|  429|Homo sapiens patatin-like phospholipase
           domain containing 5 protein.
          Length = 429

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 5/89 (5%)
 Frame = +2

Query: 32  KMRSVTVKDVEQ-DKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPXLVLCALC 208
           K+  V VKDV   +++   + A LKK          D  + ARF    P      L   C
Sbjct: 295 KVPHVQVKDVPNFEQLSPELEAALKKACT------RDPSRWARFWHSGPGQVLTYLLLPC 348

Query: 209 CHPSSYLH----SLTCWSKDCHQDLWWAQ 283
             P  Y++     L  W  D   DLWW Q
Sbjct: 349 TLPFEYIYFRSRRLVVWLPDVPADLWWMQ 377


>BC104839-1|AAI04840.1|  429|Homo sapiens patatin-like phospholipase
           domain containing 5 protein.
          Length = 429

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 5/89 (5%)
 Frame = +2

Query: 32  KMRSVTVKDVEQ-DKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPXLVLCALC 208
           K+  V VKDV   +++   + A LKK          D  + ARF    P      L   C
Sbjct: 295 KVPHVQVKDVPNFEQLSPELEAALKKACT------RDPSRWARFWHSGPGQVLTYLLLPC 348

Query: 209 CHPSSYLH----SLTCWSKDCHQDLWWAQ 283
             P  Y++     L  W  D   DLWW Q
Sbjct: 349 TLPFEYIYFRSRRLVVWLPDVPADLWWMQ 377


>BC031820-1|AAH31820.1|  429|Homo sapiens patatin-like phospholipase
           domain containing 5 protein.
          Length = 429

 Score = 30.3 bits (65), Expect = 4.4
 Identities = 27/89 (30%), Positives = 35/89 (39%), Gaps = 5/89 (5%)
 Frame = +2

Query: 32  KMRSVTVKDVEQ-DKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPXLVLCALC 208
           K+  V VKDV   +++   + A LKK          D  + ARF    P      L   C
Sbjct: 295 KVPHVQVKDVPNFEQLSPELEAALKKACT------RDPSRWARFWHSGPGQVLTYLLLPC 348

Query: 209 CHPSSYLH----SLTCWSKDCHQDLWWAQ 283
             P  Y++     L  W  D   DLWW Q
Sbjct: 349 TLPFEYIYFRSRRLVVWLPDVPADLWWMQ 377


>AL691452-3|CAI16725.1| 2039|Homo sapiens complement component (3b/4b)
            receptor 1 (Knops blood group) protein.
          Length = 2039

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 302  FTFLQVIRQYCTQGFAIVGGIEAC*ESSGRW 394
            FT  ++IR  C  GF +VG      +++GRW
Sbjct: 1609 FTLTEIIRFRCQPGFVMVGSHTVQCQTNGRW 1639


>AL691452-2|CAI16723.1| 2039|Homo sapiens complement component (3b/4b)
            receptor 1 (Knops blood group) protein.
          Length = 2039

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 302  FTFLQVIRQYCTQGFAIVGGIEAC*ESSGRW 394
            FT  ++IR  C  GF +VG      +++GRW
Sbjct: 1609 FTLTEIIRFRCQPGFVMVGSHTVQCQTNGRW 1639


>AL691452-1|CAI16724.1| 2039|Homo sapiens complement component (3b/4b)
            receptor 1 (Knops blood group) protein.
          Length = 2039

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 302  FTFLQVIRQYCTQGFAIVGGIEAC*ESSGRW 394
            FT  ++IR  C  GF +VG      +++GRW
Sbjct: 1609 FTLTEIIRFRCQPGFVMVGSHTVQCQTNGRW 1639


>AL137789-3|CAI16043.1| 2039|Homo sapiens complement component (3b/4b)
            receptor 1 (Knops blood group) protein.
          Length = 2039

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 302  FTFLQVIRQYCTQGFAIVGGIEAC*ESSGRW 394
            FT  ++IR  C  GF +VG      +++GRW
Sbjct: 1609 FTLTEIIRFRCQPGFVMVGSHTVQCQTNGRW 1639


>AL137789-2|CAI16042.1| 2039|Homo sapiens complement component (3b/4b)
            receptor 1 (Knops blood group) protein.
          Length = 2039

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 302  FTFLQVIRQYCTQGFAIVGGIEAC*ESSGRW 394
            FT  ++IR  C  GF +VG      +++GRW
Sbjct: 1609 FTLTEIIRFRCQPGFVMVGSHTVQCQTNGRW 1639


>AL137789-1|CAI16044.1| 2039|Homo sapiens complement component (3b/4b)
            receptor 1 (Knops blood group) protein.
          Length = 2039

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 302  FTFLQVIRQYCTQGFAIVGGIEAC*ESSGRW 394
            FT  ++IR  C  GF +VG      +++GRW
Sbjct: 1609 FTLTEIIRFRCQPGFVMVGSHTVQCQTNGRW 1639


>AF264715-1|AAG14442.1|  132|Homo sapiens complement receptor type 1
           protein.
          Length = 132

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 302 FTFLQVIRQYCTQGFAIVGGIEAC*ESSGRW 394
           FT  ++IR  C  GF +VG      +++GRW
Sbjct: 93  FTLTEIIRFRCQPGFVMVGSHTVQCQTNGRW 123


>AB209470-1|BAD92707.1|  249|Homo sapiens proteasome beta 2 subunit
           variant protein.
          Length = 249

 Score = 29.9 bits (64), Expect = 5.8
 Identities = 17/49 (34%), Positives = 22/49 (44%)
 Frame = +3

Query: 201 RCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKAL 347
           R   +LR      P G  + T + GGR+  G   S  CR  G   R+AL
Sbjct: 187 RAVELLRKCLEEGPGGAGSSTALGGGRRSVGQDRSSSCRRKGRGRRRAL 235


>AY701504-1|AAV65577.1|  116|Homo sapiens CR1 protein domain SCR25
           protein.
          Length = 116

 Score = 29.5 bits (63), Expect = 7.6
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +2

Query: 302 FTFLQVIRQYCTQGFAIVGGIEAC*ESSGRW 394
           FT  +++R  C  GF +VG      +++GRW
Sbjct: 84  FTLTEIVRFRCQPGFVMVGSHTVQCQTNGRW 114


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 74,736,450
Number of Sequences: 237096
Number of extensions: 1549590
Number of successful extensions: 3265
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 3017
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3265
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 5103531180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -