SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U47924-16|AAB51329.1|  126|Homo sapiens C10 protein.                   93   7e-19
BC009925-1|AAH09925.1|  126|Homo sapiens chromosome 12 open read...    93   7e-19
AF089726-1|AAG16773.1| 1090|Homo sapiens sodium bicarbonate cotr...    31   3.1  
AF053755-1|AAF21720.1| 1000|Homo sapiens bicarbonate transporter...    31   3.1  
AB012130-1|BAA25898.1| 1018|Homo sapiens sodium bicarbonate cotr...    31   3.1  
BX640827-1|CAE45903.1| 1083|Homo sapiens hypothetical protein pr...    30   7.1  
AF530058-1|AAQ09942.1|  912|Homo sapiens HBeAg-binding protein 3...    30   7.1  
AF506799-1|AAO15881.1| 1113|Homo sapiens KIBRA protein protein.        30   7.1  
AB020676-1|BAA74892.1|  888|Homo sapiens KIAA0869 protein protein.     30   7.1  
CR542062-1|CAG46859.1|  373|Homo sapiens PEX3 protein.                 29   9.4  
BC015506-1|AAH15506.1|  373|Homo sapiens peroxisomal biogenesis ...    29   9.4  
BC014551-1|AAH14551.1|  373|Homo sapiens peroxisomal biogenesis ...    29   9.4  
AY277600-1|AAQ18039.1|  373|Homo sapiens transformation-related ...    29   9.4  
AL031320-5|CAB53744.1|  373|Homo sapiens peroxisomal biogenesis ...    29   9.4  
AJ131389-1|CAA10362.1|  373|Homo sapiens PEX3 protein protein.         29   9.4  
AJ009866-1|CAA08904.1|  373|Homo sapiens Pex3p protein.                29   9.4  
AJ001625-1|CAA04879.1|  373|Homo sapiens Pex3 protein protein.         29   9.4  
AB035307-1|BAA97993.1|  373|Homo sapiens Pex3p protein.                29   9.4  

>U47924-16|AAB51329.1|  126|Homo sapiens C10 protein.
          Length = 126

 Score = 93.1 bits (221), Expect = 7e-19
 Identities = 39/107 (36%), Positives = 74/107 (69%)
 Frame = +1

Query: 130 SSPQSVSVDQMRQILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMET 309
           + P ++S +Q + +L E+I A  +P+ A ++DEA++ A N+M KM+Q V P+  QI+ E 
Sbjct: 6   TQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEV 65

Query: 310 IKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVSI 450
           IK +GF+   EG+++F +L++  E+ D E+A L  ++++ +LPP+++
Sbjct: 66  IKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTL 112


>BC009925-1|AAH09925.1|  126|Homo sapiens chromosome 12 open reading
           frame 57 protein.
          Length = 126

 Score = 93.1 bits (221), Expect = 7e-19
 Identities = 39/107 (36%), Positives = 74/107 (69%)
 Frame = +1

Query: 130 SSPQSVSVDQMRQILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMET 309
           + P ++S +Q + +L E+I A  +P+ A ++DEA++ A N+M KM+Q V P+  QI+ E 
Sbjct: 6   TQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEV 65

Query: 310 IKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHYLPPVSI 450
           IK +GF+   EG+++F +L++  E+ D E+A L  ++++ +LPP+++
Sbjct: 66  IKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTL 112


>AF089726-1|AAG16773.1| 1090|Homo sapiens sodium bicarbonate
           cotransporter 2b protein.
          Length = 1090

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 28/112 (25%), Positives = 44/112 (39%), Gaps = 1/112 (0%)
 Frame = +1

Query: 211 ASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDLESID 390
           AS LDE  +   + M+   Q+   +   +    +K H   N +        L+R    I 
Sbjct: 180 ASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKR-FTSRIPLVRSFADIG 238

Query: 391 GEVARLHTQIRSHYLP-PVSISSSVDTSL*NSIKGKTWNSSTVNGVLRFSKL 543
            + +  H   R+  L  P S   ++D S    IKG     S  N  + FSK+
Sbjct: 239 KKHSDPHLLERNGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKV 290


>AF053755-1|AAF21720.1| 1000|Homo sapiens bicarbonate transporter
           protein.
          Length = 1000

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 28/112 (25%), Positives = 44/112 (39%), Gaps = 1/112 (0%)
 Frame = +1

Query: 211 ASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDLESID 390
           AS LDE  +   + M+   Q+   +   +    +K H   N +        L+R    I 
Sbjct: 90  ASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKR-FTSRIPLVRSFADIG 148

Query: 391 GEVARLHTQIRSHYLP-PVSISSSVDTSL*NSIKGKTWNSSTVNGVLRFSKL 543
            + +  H   R+  L  P S   ++D S    IKG     S  N  + FSK+
Sbjct: 149 KKHSDPHLLERNGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKV 200


>AB012130-1|BAA25898.1| 1018|Homo sapiens sodium bicarbonate
           cotransporter2 protein.
          Length = 1018

 Score = 31.1 bits (67), Expect = 3.1
 Identities = 28/112 (25%), Positives = 44/112 (39%), Gaps = 1/112 (0%)
 Frame = +1

Query: 211 ASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDLESID 390
           AS LDE  +   + M+   Q+   +   +    +K H   N +        L+R    I 
Sbjct: 90  ASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKR-FTSRIPLVRSFADIG 148

Query: 391 GEVARLHTQIRSHYLP-PVSISSSVDTSL*NSIKGKTWNSSTVNGVLRFSKL 543
            + +  H   R+  L  P S   ++D S    IKG     S  N  + FSK+
Sbjct: 149 KKHSDPHLLERNGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKV 200


>BX640827-1|CAE45903.1| 1083|Homo sapiens hypothetical protein
           protein.
          Length = 1083

 Score = 29.9 bits (64), Expect = 7.1
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +1

Query: 361 QLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVDTSL*NSIKGKTWNSS 510
           QL+R+LE    +VA LH+Q++S      S+SS        S +G    SS
Sbjct: 369 QLVRELEEATRQVATLHSQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASS 418


>AF530058-1|AAQ09942.1|  912|Homo sapiens HBeAg-binding protein 3
           protein.
          Length = 912

 Score = 29.9 bits (64), Expect = 7.1
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +1

Query: 361 QLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVDTSL*NSIKGKTWNSS 510
           QL+R+LE    +VA LH+Q++S      S+SS        S +G    SS
Sbjct: 203 QLVRELEEATRQVATLHSQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASS 252


>AF506799-1|AAO15881.1| 1113|Homo sapiens KIBRA protein protein.
          Length = 1113

 Score = 29.9 bits (64), Expect = 7.1
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +1

Query: 361 QLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVDTSL*NSIKGKTWNSS 510
           QL+R+LE    +VA LH+Q++S      S+SS        S +G    SS
Sbjct: 404 QLVRELEEATRQVATLHSQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASS 453


>AB020676-1|BAA74892.1|  888|Homo sapiens KIAA0869 protein protein.
          Length = 888

 Score = 29.9 bits (64), Expect = 7.1
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +1

Query: 361 QLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVDTSL*NSIKGKTWNSS 510
           QL+R+LE    +VA LH+Q++S      S+SS        S +G    SS
Sbjct: 180 QLVRELEEATRQVATLHSQLKSLSSSMQSLSSGSSPGSLTSSRGSLVASS 229


>CR542062-1|CAG46859.1|  373|Homo sapiens PEX3 protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


>BC015506-1|AAH15506.1|  373|Homo sapiens peroxisomal biogenesis
           factor 3 protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


>BC014551-1|AAH14551.1|  373|Homo sapiens peroxisomal biogenesis
           factor 3 protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


>AY277600-1|AAQ18039.1|  373|Homo sapiens transformation-related
           protein 18 protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


>AL031320-5|CAB53744.1|  373|Homo sapiens peroxisomal biogenesis
           factor 3 protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


>AJ131389-1|CAA10362.1|  373|Homo sapiens PEX3 protein protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


>AJ009866-1|CAA08904.1|  373|Homo sapiens Pex3p protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


>AJ001625-1|CAA04879.1|  373|Homo sapiens Pex3 protein protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


>AB035307-1|BAA97993.1|  373|Homo sapiens Pex3p protein.
          Length = 373

 Score = 29.5 bits (63), Expect = 9.4
 Identities = 21/90 (23%), Positives = 43/90 (47%)
 Frame = +1

Query: 166 QILNEIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREG 345
           ++LNE  D LESPD+++ L+       + +L  M   F    Q     ++H    NS   
Sbjct: 262 KLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRPTEQ----DLQHGNSMNSLSS 317

Query: 346 IVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +     L + +  ++G++  + ++  SH++
Sbjct: 318 V--SLPLAKIIPIVNGQIHSVCSETPSHFV 345


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 81,941,349
Number of Sequences: 237096
Number of extensions: 1721162
Number of successful extensions: 3214
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 3114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3214
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6297951520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -