SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L38941-1|AAC41916.1|  117|Homo sapiens ribosomal protein L34 pro...   134   2e-31
CR542242-1|CAG47038.1|  117|Homo sapiens RPL34 protein.               130   3e-30
CR542232-1|CAG47028.1|  117|Homo sapiens RPL34 protein.               130   3e-30
BC106009-1|AAI06010.1|  117|Homo sapiens ribosomal protein L34 p...   130   3e-30
BC070208-1|AAH70208.1|  117|Homo sapiens ribosomal protein L34 p...   130   3e-30
BC001773-1|AAH01773.1|  117|Homo sapiens ribosomal protein L34 p...   130   3e-30
AB061832-1|BAB79470.1|  117|Homo sapiens ribosomal protein L34 p...   130   3e-30
AB007181-1|BAA25840.1|   45|Homo sapiens ribosomal protein L34 p...    60   4e-09
BC037582-1|AAH37582.1|  349|Homo sapiens ATXN7L2 protein protein.      30   3.8  
BC036849-1|AAH36849.1|  580|Homo sapiens ataxin 7-like 2 protein.      30   3.8  
AL355145-2|CAI22938.1|  349|Homo sapiens ataxin 7-like 2 protein.      30   3.8  
AL355145-1|CAI22937.1|  722|Homo sapiens ataxin 7-like 2 protein.      30   3.8  
BC113377-1|AAI13378.1| 1043|Homo sapiens F-box protein, helicase...    29   8.7  
BC113375-1|AAI13376.1| 1043|Homo sapiens F-box protein, helicase...    29   8.7  
BC110884-1|AAI10885.1|  969|Homo sapiens FBXO18 protein protein.       29   8.7  
BC080629-1|AAH80629.1|  978|Homo sapiens FBXO18 protein protein.       29   8.7  
BC032674-1|AAH32674.2|  908|Homo sapiens FBXO18 protein protein.       29   8.7  
BC012762-1|AAH12762.2|  338|Homo sapiens FBXO18 protein protein.       29   8.7  
AL137186-6|CAI41074.1| 1094|Homo sapiens F-box protein, helicase...    29   8.7  
AL137186-5|CAI41073.1| 1043|Homo sapiens F-box protein, helicase...    29   8.7  
AL133069-1|CAB61392.1|  281|Homo sapiens hypothetical protein pr...    29   8.7  
AK095343-1|BAC04535.1| 1043|Homo sapiens protein ( Homo sapiens ...    29   8.7  
AK027496-1|BAB55154.1|  779|Homo sapiens protein ( Homo sapiens ...    29   8.7  
AK027381-1|BAB55073.1|  455|Homo sapiens protein ( Homo sapiens ...    29   8.7  
AF456237-1|AAP97705.1| 1043|Homo sapiens testis protein protein.       29   8.7  
AF454502-1|AAP97700.1| 1042|Homo sapiens hypothetical protein pr...    29   8.7  
AF380349-1|AAM73631.1|  969|Homo sapiens F-box DNA helicase 1 pr...    29   8.7  

>L38941-1|AAC41916.1|  117|Homo sapiens ribosomal protein L34
           protein.
          Length = 117

 Score =  134 bits (324), Expect = 2e-31
 Identities = 68/107 (63%), Positives = 77/107 (71%), Gaps = 3/107 (2%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CGQCKSKLRGIQPAR 204
           MVQRLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG C  KLRG++P R
Sbjct: 1   MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGKLRGVRPVR 60

Query: 205 PAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQK-IVKVL 342
           P    RL   KK V R YGG +C KCV+ RI RAFLIEEQK IVKVL
Sbjct: 61  PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIIVKVL 107


>CR542242-1|CAG47038.1|  117|Homo sapiens RPL34 protein.
          Length = 117

 Score =  130 bits (313), Expect = 3e-30
 Identities = 66/107 (61%), Positives = 76/107 (71%), Gaps = 3/107 (2%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CGQCKSKLRGIQPAR 204
           MVQRLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG C  +LRG++  R
Sbjct: 1   MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR 60

Query: 205 PAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKI-VKVL 342
           P    RL   KK V R YGG +C KCV+ RI RAFLIEEQKI VKVL
Sbjct: 61  PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVL 107


>CR542232-1|CAG47028.1|  117|Homo sapiens RPL34 protein.
          Length = 117

 Score =  130 bits (313), Expect = 3e-30
 Identities = 66/107 (61%), Positives = 76/107 (71%), Gaps = 3/107 (2%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CGQCKSKLRGIQPAR 204
           MVQRLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG C  +LRG++  R
Sbjct: 1   MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR 60

Query: 205 PAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKI-VKVL 342
           P    RL   KK V R YGG +C KCV+ RI RAFLIEEQKI VKVL
Sbjct: 61  PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVL 107


>BC106009-1|AAI06010.1|  117|Homo sapiens ribosomal protein L34
           protein.
          Length = 117

 Score =  130 bits (313), Expect = 3e-30
 Identities = 66/107 (61%), Positives = 76/107 (71%), Gaps = 3/107 (2%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CGQCKSKLRGIQPAR 204
           MVQRLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG C  +LRG++  R
Sbjct: 1   MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR 60

Query: 205 PAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKI-VKVL 342
           P    RL   KK V R YGG +C KCV+ RI RAFLIEEQKI VKVL
Sbjct: 61  PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVL 107


>BC070208-1|AAH70208.1|  117|Homo sapiens ribosomal protein L34
           protein.
          Length = 117

 Score =  130 bits (313), Expect = 3e-30
 Identities = 66/107 (61%), Positives = 76/107 (71%), Gaps = 3/107 (2%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CGQCKSKLRGIQPAR 204
           MVQRLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG C  +LRG++  R
Sbjct: 1   MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR 60

Query: 205 PAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKI-VKVL 342
           P    RL   KK V R YGG +C KCV+ RI RAFLIEEQKI VKVL
Sbjct: 61  PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVL 107


>BC001773-1|AAH01773.1|  117|Homo sapiens ribosomal protein L34
           protein.
          Length = 117

 Score =  130 bits (313), Expect = 3e-30
 Identities = 66/107 (61%), Positives = 76/107 (71%), Gaps = 3/107 (2%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CGQCKSKLRGIQPAR 204
           MVQRLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG C  +LRG++  R
Sbjct: 1   MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR 60

Query: 205 PAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKI-VKVL 342
           P    RL   KK V R YGG +C KCV+ RI RAFLIEEQKI VKVL
Sbjct: 61  PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVL 107


>AB061832-1|BAB79470.1|  117|Homo sapiens ribosomal protein L34
           protein.
          Length = 117

 Score =  130 bits (313), Expect = 3e-30
 Identities = 66/107 (61%), Positives = 76/107 (71%), Gaps = 3/107 (2%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CGQCKSKLRGIQPAR 204
           MVQRLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG C  +LRG++  R
Sbjct: 1   MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRGVRAVR 60

Query: 205 PAERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKI-VKVL 342
           P    RL   KK V R YGG +C KCV+ RI RAFLIEEQKI VKVL
Sbjct: 61  PKVLMRLSKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVL 107


>AB007181-1|BAA25840.1|   45|Homo sapiens ribosomal protein L34
           protein.
          Length = 45

 Score = 60.1 bits (139), Expect = 4e-09
 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 2/44 (4%)
 Frame = +1

Query: 40  RLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPR--CG 165
           RLT+RRRLSYNT SN+ R+ RTPG R+VY Y KK  K P+  CG
Sbjct: 1   RLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACG 44


>BC037582-1|AAH37582.1|  349|Homo sapiens ATXN7L2 protein protein.
          Length = 349

 Score = 30.3 bits (65), Expect = 3.8
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
 Frame = -3

Query: 386 FVAFFADLVLACCAL--RTFTIFCSSMRKALTMRCLTHLWQRTPP 258
           F  F + LV   C +  R    FCS++   L     TH+W++ PP
Sbjct: 40  FCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSTHMWKKIPP 84


>BC036849-1|AAH36849.1|  580|Homo sapiens ataxin 7-like 2 protein.
          Length = 580

 Score = 30.3 bits (65), Expect = 3.8
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
 Frame = -3

Query: 386 FVAFFADLVLACCAL--RTFTIFCSSMRKALTMRCLTHLWQRTPP 258
           F  F + LV   C +  R    FCS++   L     TH+W++ PP
Sbjct: 413 FCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSTHMWKKIPP 457


>AL355145-2|CAI22938.1|  349|Homo sapiens ataxin 7-like 2 protein.
          Length = 349

 Score = 30.3 bits (65), Expect = 3.8
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
 Frame = -3

Query: 386 FVAFFADLVLACCAL--RTFTIFCSSMRKALTMRCLTHLWQRTPP 258
           F  F + LV   C +  R    FCS++   L     TH+W++ PP
Sbjct: 40  FCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSTHMWKKIPP 84


>AL355145-1|CAI22937.1|  722|Homo sapiens ataxin 7-like 2 protein.
          Length = 722

 Score = 30.3 bits (65), Expect = 3.8
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 2/45 (4%)
 Frame = -3

Query: 386 FVAFFADLVLACCAL--RTFTIFCSSMRKALTMRCLTHLWQRTPP 258
           F  F + LV   C +  R    FCS++   L     TH+W++ PP
Sbjct: 413 FCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSTHMWKKIPP 457


>BC113377-1|AAI13378.1| 1043|Homo sapiens F-box protein, helicase, 18
            protein.
          Length = 1043

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 960  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 1016

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 1017 PEQVRAM 1023


>BC113375-1|AAI13376.1| 1043|Homo sapiens F-box protein, helicase, 18
            protein.
          Length = 1043

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 960  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 1016

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 1017 PEQVRAM 1023


>BC110884-1|AAI10885.1|  969|Homo sapiens FBXO18 protein protein.
          Length = 969

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 886  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 942

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 943  PEQVRAM 949


>BC080629-1|AAH80629.1|  978|Homo sapiens FBXO18 protein protein.
          Length = 978

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 895  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 951

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 952  PEQVRAM 958


>BC032674-1|AAH32674.2|  908|Homo sapiens FBXO18 protein protein.
          Length = 908

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 825  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 881

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 882  PEQVRAM 888


>BC012762-1|AAH12762.2|  338|Homo sapiens FBXO18 protein protein.
          Length = 338

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151 IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
           + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 255 VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 311

Query: 322 QKIVKVL 342
            + V+ +
Sbjct: 312 PEQVRAM 318


>AL137186-6|CAI41074.1| 1094|Homo sapiens F-box protein, helicase, 18
            protein.
          Length = 1094

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 1011 VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 1067

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 1068 PEQVRAM 1074


>AL137186-5|CAI41073.1| 1043|Homo sapiens F-box protein, helicase, 18
            protein.
          Length = 1043

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 960  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 1016

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 1017 PEQVRAM 1023


>AL133069-1|CAB61392.1|  281|Homo sapiens hypothetical protein
           protein.
          Length = 281

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151 IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
           + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 198 VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 254

Query: 322 QKIVKVL 342
            + V+ +
Sbjct: 255 PEQVRAM 261


>AK095343-1|BAC04535.1| 1043|Homo sapiens protein ( Homo sapiens cDNA
            FLJ38024 fis, clone CTONG2012996, highly similar to Mus
            musculus F-box protein FBX18 mRNA. ).
          Length = 1043

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 960  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 1016

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 1017 PEQVRAM 1023


>AK027496-1|BAB55154.1|  779|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14590 fis, clone NT2RM4001880, weakly similar to
           PUTATIVE DNA HELICASE II HOMOLOG (EC 3.6.1.-). ).
          Length = 779

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151 IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
           + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 696 VVRCCVGQCNNAIP-VDTVLTMKKLLITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 752

Query: 322 QKIVKVL 342
            + V+ +
Sbjct: 753 PEQVRAM 759


>AK027381-1|BAB55073.1|  455|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14475 fis, clone MAMMA1001259, highly similar to
           Mus musculus F-box protein FBX18 mRNA. ).
          Length = 455

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151 IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
           + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 372 VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 428

Query: 322 QKIVKVL 342
            + V+ +
Sbjct: 429 PEQVRAM 435


>AF456237-1|AAP97705.1| 1043|Homo sapiens testis protein protein.
          Length = 1043

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 960  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 1016

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 1017 PEQVRAM 1023


>AF454502-1|AAP97700.1| 1042|Homo sapiens hypothetical protein
            protein.
          Length = 1042

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 959  VVRCCVGQCNNAIP-VDTVLTMKKLLITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 1015

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 1016 PEQVRAM 1022


>AF380349-1|AAM73631.1|  969|Homo sapiens F-box DNA helicase 1
            protein.
          Length = 969

 Score = 29.1 bits (62), Expect = 8.7
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = +1

Query: 151  IPRC--GQCKSKLRGIQPARPAERSRLCYRKKTVKRVYGGVLCHKCVKQRI-VRAFLIEE 321
            + RC  GQC + +  +      ++  + Y  +  K   GG LCH C +QRI   AFL   
Sbjct: 886  VVRCCVGQCNNAIP-VDTVLTMKKLPITYSNR--KENKGGYLCHSCAEQRIGPLAFLTAS 942

Query: 322  QKIVKVL 342
             + V+ +
Sbjct: 943  PEQVRAM 949


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 60,386,092
Number of Sequences: 237096
Number of extensions: 1365915
Number of successful extensions: 7488
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 7386
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7481
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 4384610846
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -