SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT007379-1|AAP36043.1|  257|Homo sapiens ribosomal protein L8 pr...   311   1e-84
BC013104-1|AAH13104.1|  257|Homo sapiens ribosomal protein L8 pr...   311   1e-84
BC012197-1|AAH12197.1|  257|Homo sapiens ribosomal protein L8 pr...   311   1e-84
Z28407-1|CAA82248.1|  257|Homo sapiens ribosomal protein L8 prot...   311   2e-84
CR457046-1|CAG33327.1|  257|Homo sapiens RPL8 protein.                311   2e-84
BC093064-1|AAH93064.1|  257|Homo sapiens ribosomal protein L8 pr...   311   2e-84
BC000077-1|AAH00077.1|  257|Homo sapiens ribosomal protein L8 pr...   311   2e-84
AB061821-1|BAB79459.1|  257|Homo sapiens ribosomal protein L8 pr...   311   2e-84
BC000047-1|AAH00047.2|  211|Homo sapiens RPL8 protein protein.        284   2e-76
AB007168-1|BAA25829.1|  130|Homo sapiens ribosomal protein L8 pr...   184   2e-46
AF132956-1|AAD27731.1|  353|Homo sapiens CGI-22 protein protein.       42   0.001
BC020212-1|AAH20212.1|  305|Homo sapiens mitochondrial ribosomal...    42   0.003
BC013685-1|AAH13685.1|  305|Homo sapiens mitochondrial ribosomal...    42   0.003
AL355385-2|CAI13780.1|  302|Homo sapiens protein ( Human DNA seq...    39   0.014
AK124779-1|BAC85944.1|  163|Homo sapiens protein ( Homo sapiens ...    30   6.3  

>BT007379-1|AAP36043.1|  257|Homo sapiens ribosomal protein L8
           protein.
          Length = 257

 Score =  311 bits (764), Expect = 1e-84
 Identities = 144/184 (78%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L VGNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNVGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>BC013104-1|AAH13104.1|  257|Homo sapiens ribosomal protein L8
           protein.
          Length = 257

 Score =  311 bits (764), Expect = 1e-84
 Identities = 144/184 (78%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L VGNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNVGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>BC012197-1|AAH12197.1|  257|Homo sapiens ribosomal protein L8
           protein.
          Length = 257

 Score =  311 bits (764), Expect = 1e-84
 Identities = 144/184 (78%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L VGNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNVGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>Z28407-1|CAA82248.1|  257|Homo sapiens ribosomal protein L8
           protein.
          Length = 257

 Score =  311 bits (763), Expect = 2e-84
 Identities = 143/184 (77%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L +GNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>CR457046-1|CAG33327.1|  257|Homo sapiens RPL8 protein.
          Length = 257

 Score =  311 bits (763), Expect = 2e-84
 Identities = 143/184 (77%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L +GNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>BC093064-1|AAH93064.1|  257|Homo sapiens ribosomal protein L8
           protein.
          Length = 257

 Score =  311 bits (763), Expect = 2e-84
 Identities = 143/184 (77%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L +GNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>BC000077-1|AAH00077.1|  257|Homo sapiens ribosomal protein L8
           protein.
          Length = 257

 Score =  311 bits (763), Expect = 2e-84
 Identities = 143/184 (77%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L +GNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>AB061821-1|BAB79459.1|  257|Homo sapiens ribosomal protein L8
           protein.
          Length = 257

 Score =  311 bits (763), Expect = 2e-84
 Identities = 143/184 (77%), Positives = 160/184 (86%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 23  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 80

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHN 464
           G++TGQFVYCGKKA L +GNV+PVG MPEGTIVC LEEK GDRG+LARASGN+ATVI HN
Sbjct: 81  GIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHN 140

Query: 465 PDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVR 644
           P+ K+TRVKLPSG+KKV+ S+NR +VG+VAGGGRIDKPILKAGRAYHKYK KRNCWP VR
Sbjct: 141 PETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVR 200

Query: 645 GVAM 656
           GVAM
Sbjct: 201 GVAM 204



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 8   QRKGAGSVFRAHVKHRKGAARLRAV 32


>BC000047-1|AAH00047.2|  211|Homo sapiens RPL8 protein protein.
          Length = 211

 Score =  284 bits (696), Expect = 2e-76
 Identities = 128/158 (81%), Positives = 142/158 (89%)
 Frame = +3

Query: 183 DIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMPVGA 362
           DIIHDPGRGAPLA V FRDPY+FK R ELFIA EG++TGQFVYCGKKA L +GNV+PVG 
Sbjct: 1   DIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGT 60

Query: 363 MPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMV 542
           MPEGTIVC LEEK GDRG+LARASGN+ATVI HNP+ K+TRVKLPSG+KKV+ S+NR +V
Sbjct: 61  MPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRAVV 120

Query: 543 GIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           G+VAGGGRIDKPILKAGRAYHKYK KRNCWP VRGVAM
Sbjct: 121 GVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM 158


>AB007168-1|BAA25829.1|  130|Homo sapiens ribosomal protein L8
           protein.
          Length = 130

 Score =  184 bits (448), Expect = 2e-46
 Identities = 86/114 (75%), Positives = 96/114 (84%)
 Frame = +3

Query: 105 RRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPE 284
           R+G A L      +AERHGYIKG+VKDIIHDPGRGAPLA V FRDPY+FK R ELFIA E
Sbjct: 19  RKGAARLRAV--DFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAE 76

Query: 285 GLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFA 446
           G++TGQFVYCGKKA L +GNV+PVG MPEGTIVC LEEK GDRG+LARASGN+A
Sbjct: 77  GIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYA 130



 Score = 39.1 bits (87), Expect = 0.014
 Identities = 17/25 (68%), Positives = 21/25 (84%)
 Frame = +2

Query: 65  QRKGAGSVFVSHTKKRKGAPKLRSL 139
           QRKGAGSVF +H K RKGA +LR++
Sbjct: 4   QRKGAGSVFRAHVKHRKGAARLRAV 28


>AF132956-1|AAD27731.1|  353|Homo sapiens CGI-22 protein protein.
          Length = 353

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 5/153 (3%)
 Frame = +3

Query: 153 RHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFV----YCGK 320
           + G  +  V  + +DP R A +A+V         +RK   IA E +  G  +    + G+
Sbjct: 118 KSGPFEEKVIQVRYDPCRSADIALV------AGGSRKRWIIATENMQAGDTILNSNHIGR 171

Query: 321 KATL-EVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLP 497
            A     G+  P+GA+P GT++ N+E + G   +  RA+G    ++        + ++LP
Sbjct: 172 MAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLL--RKVNGHSIIQLP 229

Query: 498 SGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGR 596
           S  +  +  +    VG V+      + I KAGR
Sbjct: 230 SKRQMQVLETCVATVGRVSNVDHNKRVIGKAGR 262


>BC020212-1|AAH20212.1|  305|Homo sapiens mitochondrial ribosomal
           protein L2 protein.
          Length = 305

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 5/153 (3%)
 Frame = +3

Query: 153 RHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFV----YCGK 320
           + G  +  V  + +DP R A +A+V         +RK   IA E +  G  +    + G+
Sbjct: 118 KSGPFEEKVIQVRYDPCRSADIALV------AGGSRKRWIIATENMQAGDTILNSNHIGR 171

Query: 321 KATL-EVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLP 497
            A     G+  P+GA+P GT++ N+E + G   +  RA+G    ++          ++LP
Sbjct: 172 MAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLL--RKVNGTAIIQLP 229

Query: 498 SGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGR 596
           S  +  +  +    VG V+      + I KAGR
Sbjct: 230 SKRQMQVLETCVATVGRVSNVDHNKRVIGKAGR 262


>BC013685-1|AAH13685.1|  305|Homo sapiens mitochondrial ribosomal
           protein L2 protein.
          Length = 305

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 5/153 (3%)
 Frame = +3

Query: 153 RHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFV----YCGK 320
           + G  +  V  + +DP R A +A+V         +RK   IA E +  G  +    + G+
Sbjct: 118 KSGPFEEKVIQVRYDPCRSADIALV------AGGSRKRWIIATENMQAGDTILNSNHIGR 171

Query: 321 KATL-EVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLP 497
            A     G+  P+GA+P GT++ N+E + G   +  RA+G    ++          ++LP
Sbjct: 172 MAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLL--RKVNGTAIIQLP 229

Query: 498 SGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGR 596
           S  +  +  +    VG V+      + I KAGR
Sbjct: 230 SKRQMQVLETCVATVGRVSNVDHNKRVIGKAGR 262


>AL355385-2|CAI13780.1|  302|Homo sapiens protein ( Human DNA
           sequence from clone RP11-387M24 on chromosome 6 Contains
            the 5' end of a gene for a novel protein (KIAA0076
           KIAA0708), the  ).
          Length = 302

 Score = 39.1 bits (87), Expect = 0.014
 Identities = 32/119 (26%), Positives = 55/119 (46%), Gaps = 5/119 (4%)
 Frame = +3

Query: 255 TRKELFIAPEGLYTGQFV----YCGKKATL-EVGNVMPVGAMPEGTIVCNLEEKMGDRGR 419
           +RK   IA E +  G  +    + G+ A     G+  P+GA+P GT++ N+E + G   +
Sbjct: 143 SRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQ 202

Query: 420 LARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGR 596
             RA+G    ++          ++LPS  +  +  +    VG V+      + I KAGR
Sbjct: 203 YIRAAGTCGVLL--RKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKAGR 259


>AK124779-1|BAC85944.1|  163|Homo sapiens protein ( Homo sapiens
           cDNA FLJ42789 fis, clone BRAWH3007221. ).
          Length = 163

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 13/33 (39%), Positives = 22/33 (66%), Gaps = 1/33 (3%)
 Frame = -2

Query: 625 LRLTLYLWYAL-PAFKIGLSIRPPPATIPTMPL 530
           L LT +L+ A  P F++ +S+ PPP ++P  P+
Sbjct: 87  LFLTHFLYLAASPCFRLSVSLFPPPLSLPRSPI 119


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,241,755
Number of Sequences: 237096
Number of extensions: 2421183
Number of successful extensions: 5380
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 5081
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5379
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7366354010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -