SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR457279-1|CAG33560.1|  330|Homo sapiens WDR5B protein.                32   1.6  
BX649632-1|CAI18774.1|  334|Homo sapiens WD repeat domain 5 prot...    32   1.6  
BC043494-1|AAH43494.1|  330|Homo sapiens WD repeat domain 5B pro...    32   1.6  
BC001635-1|AAH01635.1|  334|Homo sapiens WD repeat domain 5 prot...    32   1.6  
AK002149-1|BAA92110.1|  330|Homo sapiens protein ( Homo sapiens ...    32   1.6  
AK000552-1|BAA91248.1|  334|Homo sapiens protein ( Homo sapiens ...    32   1.6  
AJ011376-1|CAB66159.1|  362|Homo sapiens hypothetical protein pr...    32   1.6  
AF492460-1|AAN64030.1| 1322|Homo sapiens WD repeat 17 protein.         31   4.7  

>CR457279-1|CAG33560.1|  330|Homo sapiens WDR5B protein.
          Length = 330

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQT  + QK+Q
Sbjct: 256 YCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 294


>BX649632-1|CAI18774.1|  334|Homo sapiens WD repeat domain 5
           protein.
          Length = 334

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQT  + QK+Q
Sbjct: 260 YCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298


>BC043494-1|AAH43494.1|  330|Homo sapiens WD repeat domain 5B
           protein.
          Length = 330

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQT  + QK+Q
Sbjct: 256 YCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 294


>BC001635-1|AAH01635.1|  334|Homo sapiens WD repeat domain 5
           protein.
          Length = 334

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQT  + QK+Q
Sbjct: 260 YCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298


>AK002149-1|BAA92110.1|  330|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11287 fis, clone PLACE1009596, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1. ).
          Length = 330

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQT  + QK+Q
Sbjct: 256 YCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 294


>AK000552-1|BAA91248.1|  334|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20545 fis, clone KAT11476. ).
          Length = 334

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQT  + QK+Q
Sbjct: 260 YCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298


>AJ011376-1|CAB66159.1|  362|Homo sapiens hypothetical protein
           protein.
          Length = 362

 Score = 32.3 bits (70), Expect = 1.6
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQT  + QK+Q
Sbjct: 288 YCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 326


>AF492460-1|AAN64030.1| 1322|Homo sapiens WD repeat 17 protein.
          Length = 1322

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = +2

Query: 104 VQKWHCFLRXPVYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQK 283
           ++ W       VYT    + V +YSL  S+ PGGL  +  G+     + +N+Q  ++ Q+
Sbjct: 418 IKVWDINTLTAVYTSPGNEGV-IYSL--SWAPGGLNCIAGGTSRNGAFIWNVQKGKIIQR 474


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 87,099,332
Number of Sequences: 237096
Number of extensions: 1739023
Number of successful extensions: 6696
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 6558
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6696
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7310122300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -