SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A15
         (409 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U58682-1|AAB07066.1|   69|Homo sapiens ribosomal protein S28 pro...    87   2e-17
L05091-1|AAC15855.1|   69|Homo sapiens ribosomal protein S28 pro...    87   2e-17
CR457055-1|CAG33336.1|   69|Homo sapiens RPS28 protein.                87   2e-17
BC070218-1|AAH70218.1|   69|Homo sapiens ribosomal protein S28 p...    87   2e-17
BC070217-1|AAH70217.1|   69|Homo sapiens ribosomal protein S28 p...    87   2e-17
BC021239-1|AAH21239.1|   69|Homo sapiens ribosomal protein S28 p...    87   2e-17
BC000354-1|AAH00354.1|   69|Homo sapiens ribosomal protein S28 p...    87   2e-17
AB061846-1|BAB79484.1|   69|Homo sapiens ribosomal protein S28 p...    87   2e-17
AL023513-1|CAI19979.1|   57|Homo sapiens protein ( Human DNA seq...    43   5e-04
Y11151-1|CAA72037.1|  118|Homo sapiens phenylpyruvate tautomeras...    29   4.6  
U84143-1|AAB41503.1|  118|Homo sapiens D-dopachrome tautomerase ...    29   4.6  
U49785-1|AAB48546.1|  118|Homo sapiens D-dopachrome tautomerase ...    29   4.6  
CR456431-1|CAG30317.1|  118|Homo sapiens DDT protein.                  29   4.6  
BT006970-1|AAP35616.1|  118|Homo sapiens D-dopachrome tautomeras...    29   4.6  
BC015508-1|AAH15508.1|  118|Homo sapiens D-dopachrome tautomeras...    29   4.6  
BC005971-1|AAH05971.1|  118|Homo sapiens D-dopachrome tautomeras...    29   4.6  
AF058293-1|AAC13717.1|  118|Homo sapiens D-dopachrome tautomeras...    29   4.6  
AF012434-1|AAC77468.1|  118|Homo sapiens D-dopachrome tautomeras...    29   4.6  

>U58682-1|AAB07066.1|   69|Homo sapiens ribosomal protein S28
           protein.
          Length = 69

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>L05091-1|AAC15855.1|   69|Homo sapiens ribosomal protein S28
           protein.
          Length = 69

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>CR457055-1|CAG33336.1|   69|Homo sapiens RPS28 protein.
          Length = 69

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>BC070218-1|AAH70218.1|   69|Homo sapiens ribosomal protein S28
           protein.
          Length = 69

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>BC070217-1|AAH70217.1|   69|Homo sapiens ribosomal protein S28
           protein.
          Length = 69

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>BC021239-1|AAH21239.1|   69|Homo sapiens ribosomal protein S28
           protein.
          Length = 69

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>BC000354-1|AAH00354.1|   69|Homo sapiens ribosomal protein S28
           protein.
          Length = 69

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>AB061846-1|BAB79484.1|   69|Homo sapiens ribosomal protein S28
           protein.
          Length = 69

 Score = 87.4 bits (207), Expect = 2e-17
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = +2

Query: 77  KPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           +P  LARV KVLGRTGSQGQCTQV+VEF+ +TSR IIRNVKGPVR+GD+LT
Sbjct: 7   QPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT 57


>AL023513-1|CAI19979.1|   57|Homo sapiens protein ( Human DNA
           sequence from clone RP1-268D13 on chromosome
           22q11.21-12.2.  ).
          Length = 57

 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 20/37 (54%), Positives = 26/37 (70%)
 Frame = +2

Query: 80  PNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIR 190
           P  L +  KVLGRT SQGQCT+V VEF+   S+++ R
Sbjct: 8   PVKLVKATKVLGRTSSQGQCTRVCVEFMVSQSKRLRR 44


>Y11151-1|CAA72037.1|  118|Homo sapiens phenylpyruvate tautomerase
           II protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


>U84143-1|AAB41503.1|  118|Homo sapiens D-dopachrome tautomerase
           protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


>U49785-1|AAB48546.1|  118|Homo sapiens D-dopachrome tautomerase
           protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


>CR456431-1|CAG30317.1|  118|Homo sapiens DDT protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


>BT006970-1|AAP35616.1|  118|Homo sapiens D-dopachrome tautomerase
           protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


>BC015508-1|AAH15508.1|  118|Homo sapiens D-dopachrome tautomerase
           protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


>BC005971-1|AAH05971.1|  118|Homo sapiens D-dopachrome tautomerase
           protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


>AF058293-1|AAC13717.1|  118|Homo sapiens D-dopachrome tautomerase
           protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


>AF012434-1|AAC77468.1|  118|Homo sapiens D-dopachrome tautomerase
           protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 4.6
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +2

Query: 2   AFRNTPALVARVLIALSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIG 166
           A R    L  R+  A +SIL    D+ NV  R    +  +GS   C Q+ +  IG
Sbjct: 12  ANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIG 66


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 57,129,694
Number of Sequences: 237096
Number of extensions: 1009364
Number of successful extensions: 1825
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1805
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1825
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 3043111070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -