SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A12
         (413 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L04483-1|AAA99893.1|   83|Homo sapiens ribosomal protein S21 pro...    68   1e-11
CR542132-1|CAG46929.1|   83|Homo sapiens RPS21 protein.                68   1e-11
BC021990-1|AAH21990.1|   83|Homo sapiens ribosomal protein S21 p...    68   1e-11
AL121832-3|CAC21458.1|   83|Homo sapiens ribosomal protein S21 p...    68   1e-11
AJ250907-1|CAB83213.1|   83|Homo sapiens ribosomal protein S21 p...    68   1e-11
AB061843-1|BAB79481.1|   83|Homo sapiens ribosomal protein S21 p...    68   1e-11
BC018140-1|AAH18140.1|   81|Homo sapiens RPS21 protein protein.        64   2e-10
X79563-1|CAA56100.2|   97|Homo sapiens 8.2 kDa differentiation f...    63   3e-10
BC027976-1|AAH27976.1|   66|Homo sapiens RPS21 protein protein.        63   3e-10
AL121832-2|CAC29248.1|   90|Homo sapiens ribosomal protein S21 p...    63   3e-10
AL121832-1|CAC29247.1|   66|Homo sapiens ribosomal protein S21 p...    63   3e-10
AB007157-1|BAA25821.1|   54|Homo sapiens ribosomal protein S21 p...    55   8e-08

>L04483-1|AAA99893.1|   83|Homo sapiens ribosomal protein S21
           protein.
          Length = 83

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/51 (58%), Positives = 38/51 (74%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 301
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++KN+
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF 83



 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>CR542132-1|CAG46929.1|   83|Homo sapiens RPS21 protein.
          Length = 83

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/51 (58%), Positives = 38/51 (74%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 301
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++KN+
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF 83



 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>BC021990-1|AAH21990.1|   83|Homo sapiens ribosomal protein S21
           protein.
          Length = 83

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/51 (58%), Positives = 38/51 (74%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 301
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++KN+
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF 83



 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>AL121832-3|CAC21458.1|   83|Homo sapiens ribosomal protein S21
           protein.
          Length = 83

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/51 (58%), Positives = 38/51 (74%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 301
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++KN+
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF 83



 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>AJ250907-1|CAB83213.1|   83|Homo sapiens ribosomal protein S21
           protein.
          Length = 83

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/51 (58%), Positives = 38/51 (74%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 301
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++KN+
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF 83



 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>AB061843-1|BAB79481.1|   83|Homo sapiens ribosomal protein S21
           protein.
          Length = 83

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/51 (58%), Positives = 38/51 (74%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 301
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++KN+
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSKNF 83



 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>BC018140-1|AAH18140.1|   81|Homo sapiens RPS21 protein protein.
          Length = 81

 Score = 64.1 bits (149), Expect = 2e-10
 Identities = 29/49 (59%), Positives = 36/49 (73%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAK 295
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K DGI++K
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGIVSK 81



 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>X79563-1|CAA56100.2|   97|Homo sapiens 8.2 kDa differentiation
           factor protein.
          Length = 97

 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>BC027976-1|AAH27976.1|   66|Homo sapiens RPS21 protein protein.
          Length = 66

 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>AL121832-2|CAC29248.1|   90|Homo sapiens ribosomal protein S21
           protein.
          Length = 90

 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31



 Score = 37.1 bits (82), Expect = 0.023
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRM 238
           Q+ +A+VD  TGR     K Y +CGAIRRM
Sbjct: 33  QMNVAEVDKVTGRFNGQFKTYAICGAIRRM 62


>AL121832-1|CAC29247.1|   66|Homo sapiens ribosomal protein S21
           protein.
          Length = 66

 Score = 63.3 bits (147), Expect = 3e-10
 Identities = 28/31 (90%), Positives = 29/31 (93%)
 Frame = +1

Query: 52  MQNDAGEFVDLYCPRKCSASNRLIHAKDHAS 144
           MQNDAGEFVDLY PRKCSASNR+I AKDHAS
Sbjct: 1   MQNDAGEFVDLYVPRKCSASNRIIGAKDHAS 31


>AB007157-1|BAA25821.1|   54|Homo sapiens ribosomal protein S21
           protein.
          Length = 54

 Score = 55.2 bits (127), Expect = 8e-08
 Identities = 25/42 (59%), Positives = 30/42 (71%)
 Frame = +2

Query: 149 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTK 274
           Q+ +A+VD  TGR     K Y +CGAIRRMGESDD I+RL K
Sbjct: 13  QMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAK 54


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 50,188,589
Number of Sequences: 237096
Number of extensions: 918915
Number of successful extensions: 1680
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1621
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1680
length of database: 76,859,062
effective HSP length: 83
effective length of database: 57,180,094
effective search space used: 3087725076
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -