SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U78027-3|AAB64204.1|  106|Homo sapiens L44-like ribosomal protei...    82   8e-16
M15661-1|AAA36589.1|  106|Homo sapiens protein ( Human ribosomal...    82   8e-16
CR542198-1|CAG46995.1|  106|Homo sapiens RPL36A protein.               82   8e-16
CR542166-1|CAG46963.1|  106|Homo sapiens RPL36AL protein.              82   8e-16
BC107716-1|AAI07717.1|  106|Homo sapiens ribosomal protein L36a-...    82   8e-16
BC070207-1|AAH70207.1|  106|Homo sapiens ribosomal protein L36a-...    82   8e-16
BC070204-1|AAH70204.1|  106|Homo sapiens ribosomal protein L36a ...    82   8e-16
BC062219-1|AAH62219.1|  106|Homo sapiens ribosomal protein L36a ...    82   8e-16
BC031015-1|AAH31015.1|  106|Homo sapiens ribosomal protein L36a ...    82   8e-16
BC003145-1|AAH03145.1|  106|Homo sapiens ribosomal protein L36a-...    82   8e-16
BC001781-1|AAH01781.1|  106|Homo sapiens ribosomal protein L36a ...    82   8e-16
BC000741-1|AAH00741.1|  106|Homo sapiens ribosomal protein L36a-...    82   8e-16
AY927233-1|AAX08138.1|  106|Homo sapiens cell growth-inhibiting ...    82   8e-16
AY305871-1|AAQ95213.1|  106|Homo sapiens migration-inducing prot...    82   8e-16
AL035422-5|CAI42360.1|  106|Homo sapiens ribosomal protein L36a ...    82   8e-16
AB063609-1|BAC19836.1|  106|Homo sapiens ribosomal protein L36a-...    82   8e-16
BC058160-1|AAH58160.1|   25|Homo sapiens LOC554234 protein protein.    44   2e-04
AJ291390-1|CAC19572.1|  901|Homo sapiens MUC3B mucin protein.          31   1.4  
AB038783-1|BAB12117.1|  878|Homo sapiens intestinal mucin protein.     31   1.4  
AB038781-1|BAB12115.1|  878|Homo sapiens intestinal mucin protein.     31   1.4  
AF113616-1|AAF13032.1| 1217|Homo sapiens intestinal mucin 3 prot...    31   2.5  
AF007194-1|AAC02272.1|  957|Homo sapiens mucin protein.                31   2.5  
AC006530-6|AAD30184.1|  391|Homo sapiens hypothetical protein pr...    31   2.5  
AB038784-1|BAB12118.1|  877|Homo sapiens intestinal mucin protein.     31   2.5  
AB038782-1|BAB12116.1|  878|Homo sapiens intestinal mucin protein.     31   2.5  

>U78027-3|AAB64204.1|  106|Homo sapiens L44-like ribosomal protein
           protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>M15661-1|AAA36589.1|  106|Homo sapiens protein ( Human ribosomal
           protein mRNA, complete cds. ).
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>CR542198-1|CAG46995.1|  106|Homo sapiens RPL36A protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>CR542166-1|CAG46963.1|  106|Homo sapiens RPL36AL protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC107716-1|AAI07717.1|  106|Homo sapiens ribosomal protein
           L36a-like protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC070207-1|AAH70207.1|  106|Homo sapiens ribosomal protein
           L36a-like protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC070204-1|AAH70204.1|  106|Homo sapiens ribosomal protein L36a
           protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC062219-1|AAH62219.1|  106|Homo sapiens ribosomal protein L36a
           protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC031015-1|AAH31015.1|  106|Homo sapiens ribosomal protein L36a
           protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC003145-1|AAH03145.1|  106|Homo sapiens ribosomal protein
           L36a-like protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC001781-1|AAH01781.1|  106|Homo sapiens ribosomal protein L36a
           protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC000741-1|AAH00741.1|  106|Homo sapiens ribosomal protein
           L36a-like protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>AY927233-1|AAX08138.1|  106|Homo sapiens cell growth-inhibiting
           protein 15 protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>AY305871-1|AAQ95213.1|  106|Homo sapiens migration-inducing protein
           6 protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>AL035422-5|CAI42360.1|  106|Homo sapiens ribosomal protein L36a
           protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>AB063609-1|BAC19836.1|  106|Homo sapiens ribosomal protein
           L36a-like protein.
          Length = 106

 Score = 82.2 bits (194), Expect = 8e-16
 Identities = 37/59 (62%), Positives = 44/59 (74%), Gaps = 2/59 (3%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECAD--CKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           YGGQ+KPIF         IVLRLEC +  C+ +  +A+KRCKHFELGGDKKRKGQ+IQF
Sbjct: 48  YGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF 106



 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/37 (45%), Positives = 20/37 (54%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPK RRT+            +QYKK K+   AQG
Sbjct: 1   MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG 37


>BC058160-1|AAH58160.1|   25|Homo sapiens LOC554234 protein protein.
          Length = 25

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 18/24 (75%), Positives = 22/24 (91%)
 Frame = +2

Query: 353 VALKRCKHFELGGDKKRKGQMIQF 424
           + +KR KHF+LGGDKKRKGQ+IQF
Sbjct: 2   LTIKRYKHFKLGGDKKRKGQVIQF 25


>AJ291390-1|CAC19572.1|  901|Homo sapiens MUC3B mucin protein.
          Length = 901

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -2

Query: 240 TIITSSXPGQRAFPWTFCTVIPCVLCGIYIFC--STSCAVLVRSPFLSSFGTISTNVKKR 67
           TII SS P   +    F T I  V    YIF   +   A +   P LSS  T ST+    
Sbjct: 265 TIIMSSSPSSASITPVFATTIHSVPSSPYIFSTENVGSASITAFPSLSSSSTTSTSPTSS 324

Query: 66  YFNPAMT 46
               A+T
Sbjct: 325 SLTTALT 331


>AB038783-1|BAB12117.1|  878|Homo sapiens intestinal mucin protein.
          Length = 878

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -2

Query: 240 TIITSSXPGQRAFPWTFCTVIPCVLCGIYIFC--STSCAVLVRSPFLSSFGTISTNVKKR 67
           TII SS P   +    F T I  V    YIF   +   A +   P LSS  T ST+    
Sbjct: 242 TIIMSSSPSSASITPVFATTIHSVPSSPYIFSTENVGSASITAFPSLSSSSTTSTSPTSS 301

Query: 66  YFNPAMT 46
               A+T
Sbjct: 302 SLTTALT 308


>AB038781-1|BAB12115.1|  878|Homo sapiens intestinal mucin protein.
          Length = 878

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -2

Query: 240 TIITSSXPGQRAFPWTFCTVIPCVLCGIYIFC--STSCAVLVRSPFLSSFGTISTNVKKR 67
           TII SS P   +    F T I  V    YIF   +   A +   P LSS  T ST+    
Sbjct: 242 TIIMSSSPSSASITPVFATTIHSVPSSPYIFSTENVGSASITAFPSLSSSSTTSTSPTSS 301

Query: 66  YFNPAMT 46
               A+T
Sbjct: 302 SLTTALT 308


>AF113616-1|AAF13032.1| 1217|Homo sapiens intestinal mucin 3
           protein.
          Length = 1217

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -2

Query: 240 TIITSSXPGQRAFPWTFCTVIPCVLCGIYIFC--STSCAVLVRSPFLSSFGTISTNVKKR 67
           TII SS P   +    F T I  V    YIF   +   A +   P LSS  T ST+    
Sbjct: 581 TIIMSSSPSSASITPVFSTTIHSVPSSPYIFSTENVGSASITGFPSLSSSATTSTSSTSS 640

Query: 66  YFNPAMT 46
               A+T
Sbjct: 641 SLTTALT 647


>AF007194-1|AAC02272.1|  957|Homo sapiens mucin protein.
          Length = 957

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -2

Query: 240 TIITSSXPGQRAFPWTFCTVIPCVLCGIYIFC--STSCAVLVRSPFLSSFGTISTNVKKR 67
           TII SS P   +    F T I  V    YIF   +   A +   P LSS  T ST+    
Sbjct: 581 TIIMSSSPSSASITPVFSTTIHSVPSSPYIFSTENVGSASITGFPSLSSSATTSTSSTSS 640

Query: 66  YFNPAMT 46
               A+T
Sbjct: 641 SLTTALT 647


>AC006530-6|AAD30184.1|  391|Homo sapiens hypothetical protein
           protein.
          Length = 391

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = +2

Query: 74  LTFVDIVPNELKNGERT--KTAQDVLQKM*MPQSTQGITVQKVQGKARCPG 220
           L FV+   NEL+ G  T  K+  ++LQ     Q T  +TVQKV     C G
Sbjct: 252 LCFVEREANELRRGRSTVTKSIVELLQTTGGIQGTLPLTVQKVLASQACHG 302


>AB038784-1|BAB12118.1|  877|Homo sapiens intestinal mucin protein.
          Length = 877

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -2

Query: 240 TIITSSXPGQRAFPWTFCTVIPCVLCGIYIFC--STSCAVLVRSPFLSSFGTISTNVKKR 67
           TII SS P   +    F T I  V    YIF   +   A +   P LSS  T ST+    
Sbjct: 241 TIIMSSSPSSASITPVFSTTIHSVPSSPYIFSTENVGSASITGFPSLSSSATTSTSSTSS 300

Query: 66  YFNPAMT 46
               A+T
Sbjct: 301 SLTTALT 307


>AB038782-1|BAB12116.1|  878|Homo sapiens intestinal mucin protein.
          Length = 878

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -2

Query: 240 TIITSSXPGQRAFPWTFCTVIPCVLCGIYIFC--STSCAVLVRSPFLSSFGTISTNVKKR 67
           TII SS P   +    F T I  V    YIF   +   A +   P LSS  T ST+    
Sbjct: 241 TIIMSSSPSSASITPVFSTTIHSVPSSPYIFSTENVGSASITGFPSLSSSATTSTSSTSS 300

Query: 66  YFNPAMT 46
               A+T
Sbjct: 301 SLTTALT 307


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 63,207,166
Number of Sequences: 237096
Number of extensions: 1241078
Number of successful extensions: 2676
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 2574
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2660
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 3815180866
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -