SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U12202-2|AAB08007.1|  130|Homo sapiens ribosomal protein S24 pro...   213   4e-55
U12202-1|AAB08006.1|  133|Homo sapiens ribosomal protein S24 pro...   213   4e-55
M31520-2|AAA36588.1|  133|Homo sapiens ribosomal protein S24 pro...   213   4e-55
BC071926-1|AAH71926.1|  130|Homo sapiens ribosomal protein S24 p...   213   4e-55
BC000523-1|AAH00523.1|  130|Homo sapiens ribosomal protein S24 p...   213   4e-55
AL512628-3|CAI16468.1|  133|Homo sapiens ribosomal protein S24 p...   213   4e-55
AL512628-2|CAI16467.1|  130|Homo sapiens ribosomal protein S24 p...   213   4e-55
BX537975-1|CAD97939.1|  132|Homo sapiens hypothetical protein pr...   212   1e-54
BC004173-1|AAH04173.1| 1500|Homo sapiens ANKRD17 protein protein.      35   0.29 
BC130280-1|AAI30281.1| 1621|Homo sapiens ABCA8 protein protein.        31   3.6  
AB231746-1|BAE17134.1|  567|Homo sapiens hypothetical protein pr...    31   3.6  
AB020629-1|BAA74845.2| 1591|Homo sapiens KIAA0822 protein protein.     31   3.6  
AK000295-1|BAA91063.1|  686|Homo sapiens protein ( Homo sapiens ...    31   4.7  
AB231747-1|BAE17135.1|  490|Homo sapiens hypothetical protein pr...    31   4.7  
BC127700-1|AAI27701.1|  520|Homo sapiens INSC protein protein.         30   6.3  
BC126410-1|AAI26411.1|  516|Homo sapiens leucine rich repeat tra...    30   6.3  
BC126408-1|AAI26409.1|  516|Homo sapiens leucine rich repeat tra...    30   6.3  
AY182026-1|AAO67547.1|  516|Homo sapiens leucine-rich repeat tra...    30   6.3  
AB236159-1|BAE93464.1|  579|Homo sapiens Inscuteable long form p...    30   6.3  
AB236158-1|BAE93463.1|  532|Homo sapiens Inscuteable short form ...    30   6.3  
AB231745-1|BAE17133.1|  532|Homo sapiens hypothetical protein pr...    30   6.3  
AB014597-1|BAA31672.2| 2486|Homo sapiens KIAA0697 protein protein.     30   6.3  
AB007876-1|BAA24846.2|  529|Homo sapiens KIAA0416 protein.             30   6.3  
AY256461-1|AAP12522.1|  921|Homo sapiens zinc in-between-ring-fi...    30   8.3  

>U12202-2|AAB08007.1|  130|Homo sapiens ribosomal protein S24
           protein.
          Length = 130

 Score =  213 bits (521), Expect = 4e-55
 Identities = 99/117 (84%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +RKQRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT 120


>U12202-1|AAB08006.1|  133|Homo sapiens ribosomal protein S24
           protein.
          Length = 133

 Score =  213 bits (521), Expect = 4e-55
 Identities = 99/117 (84%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +RKQRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT 120


>M31520-2|AAA36588.1|  133|Homo sapiens ribosomal protein S24
           protein.
          Length = 133

 Score =  213 bits (521), Expect = 4e-55
 Identities = 99/117 (84%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +RKQRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT 120


>BC071926-1|AAH71926.1|  130|Homo sapiens ribosomal protein S24
           protein.
          Length = 130

 Score =  213 bits (521), Expect = 4e-55
 Identities = 99/117 (84%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +RKQRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT 120


>BC000523-1|AAH00523.1|  130|Homo sapiens ribosomal protein S24
           protein.
          Length = 130

 Score =  213 bits (521), Expect = 4e-55
 Identities = 99/117 (84%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +RKQRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT 120


>AL512628-3|CAI16468.1|  133|Homo sapiens ribosomal protein S24
           protein.
          Length = 133

 Score =  213 bits (521), Expect = 4e-55
 Identities = 99/117 (84%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +RKQRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT 120


>AL512628-2|CAI16467.1|  130|Homo sapiens ribosomal protein S24
           protein.
          Length = 130

 Score =  213 bits (521), Expect = 4e-55
 Identities = 99/117 (84%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +RKQRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT 120


>BX537975-1|CAD97939.1|  132|Homo sapiens hypothetical protein
           protein.
          Length = 132

 Score =  212 bits (517), Expect = 1e-54
 Identities = 98/117 (83%), Positives = 107/117 (91%)
 Frame = +1

Query: 100 TATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFGFKTN 279
           T TIRTRKFMTNRLL RKQMV DVLHPGK TV KTEIREKLAKMYK TPDV+FVFGF+T+
Sbjct: 4   TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTH 63

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRGT 450
           FGGGK+TGF +IYD+LD AKK EPKHRLARHGLYEKK+ +R+QRKERKNRMKKVRGT
Sbjct: 64  FGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSREQRKERKNRMKKVRGT 120


>BC004173-1|AAH04173.1| 1500|Homo sapiens ANKRD17 protein protein.
          Length = 1500

 Score = 34.7 bits (76), Expect = 0.29
 Identities = 16/44 (36%), Positives = 27/44 (61%)
 Frame = +1

Query: 307  ALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
            +++ + LDL K  E   RLA     EKK+  +K++K++K + KK
Sbjct: 1457 SILLEELDLEKLREESRRLALAAKREKKKKKKKKKKKKKKKKKK 1500


>BC130280-1|AAI30281.1| 1621|Homo sapiens ABCA8 protein protein.
          Length = 1621

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -1

Query: 491  SHHFLEAAPTLDFLVPRTFFILFLRSLRCL 402
            S   ++  P L FL+P   FI+FL +LRCL
Sbjct: 1191 SEERMDVQPFLVFLIPFLHFIIFLFTLRCL 1220


>AB231746-1|BAE17134.1|  567|Homo sapiens hypothetical protein
           protein.
          Length = 567

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -3

Query: 435 LHSVLTFFTLFARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*LATSEVCLETEYE 256
           +HS+    T  AR  +    AV+      L+ +G+IE ++ +  S   A +E CL+ E E
Sbjct: 103 VHSMSVRLTCHARSMVSEYSAVSR---NSLKEMGEIEKLLMEKCSELSAVTERCLQVENE 159

Query: 255 HYIGSNLVHFGELLTDLG 202
           H + S      E L+ LG
Sbjct: 160 HVLKSTKACVSETLSMLG 177


>AB020629-1|BAA74845.2| 1591|Homo sapiens KIAA0822 protein protein.
          Length = 1591

 Score = 31.1 bits (67), Expect = 3.6
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -1

Query: 491  SHHFLEAAPTLDFLVPRTFFILFLRSLRCL 402
            S   ++  P L FL+P   FI+FL +LRCL
Sbjct: 1161 SEERMDVQPFLVFLIPFLHFIIFLFTLRCL 1190


>AK000295-1|BAA91063.1|  686|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20288 fis, clone HEP04414. ).
          Length = 686

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +1

Query: 307 ALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           +++   LDL K  E   + A     EK++  RK++K++K + KK
Sbjct: 640 SILLKELDLEKSREESRKQALAAKREKRKEKRKKKKKKKKKKKK 683


>AB231747-1|BAE17135.1|  490|Homo sapiens hypothetical protein
           protein.
          Length = 490

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -3

Query: 435 LHSVLTFFTLFARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*LATSEVCLETEYE 256
           +HS+    T  AR  +    AV+      L+ +G+IE ++ +  S   A +E CL+ E E
Sbjct: 103 VHSMSVRLTCHARSMVSEYSAVSR---NSLKEMGEIEKLLMEKCSELSAVTERCLQVENE 159

Query: 255 HYIGSNLVHFGELLTDLG 202
           H + S      E L+ LG
Sbjct: 160 HVLKSMKACMSETLSMLG 177


>BC127700-1|AAI27701.1|  520|Homo sapiens INSC protein protein.
          Length = 520

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -3

Query: 435 LHSVLTFFTLFARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*LATSEVCLETEYE 256
           +HS+    T  AR  +    AV+      L+ +G+IE ++ +  S   A +E CL+ E E
Sbjct: 103 VHSMSVRLTCHARSMVSEYSAVSR---NSLKEMGEIEKLLMEKCSELSAVTERCLQVENE 159

Query: 255 HYIGSNLVHFGELLTDLG 202
           H + S      E L+ LG
Sbjct: 160 HVLKSMKACVSETLSMLG 177


>BC126410-1|AAI26411.1|  516|Homo sapiens leucine rich repeat
           transmembrane neuronal 2 protein.
          Length = 516

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -1

Query: 311 KANPVDLPPPKFVLKPNTNTTSGVTLYIL-ASFSRISVLLTVGFPGCKTSQTICLRANNL 135
           K   + L   K    PNT  T  + L  L  SF+++S L    F G +  QT+ LR+N+L
Sbjct: 110 KLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSL 169

Query: 134 LVMNLRV 114
             + +R+
Sbjct: 170 RTIPVRL 176


>BC126408-1|AAI26409.1|  516|Homo sapiens leucine rich repeat
           transmembrane neuronal 2 protein.
          Length = 516

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -1

Query: 311 KANPVDLPPPKFVLKPNTNTTSGVTLYIL-ASFSRISVLLTVGFPGCKTSQTICLRANNL 135
           K   + L   K    PNT  T  + L  L  SF+++S L    F G +  QT+ LR+N+L
Sbjct: 110 KLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSL 169

Query: 134 LVMNLRV 114
             + +R+
Sbjct: 170 RTIPVRL 176


>AY182026-1|AAO67547.1|  516|Homo sapiens leucine-rich repeat
           transmembrane neuronal 2 protein protein.
          Length = 516

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -1

Query: 311 KANPVDLPPPKFVLKPNTNTTSGVTLYIL-ASFSRISVLLTVGFPGCKTSQTICLRANNL 135
           K   + L   K    PNT  T  + L  L  SF+++S L    F G +  QT+ LR+N+L
Sbjct: 110 KLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSL 169

Query: 134 LVMNLRV 114
             + +R+
Sbjct: 170 RTIPVRL 176


>AB236159-1|BAE93464.1|  579|Homo sapiens Inscuteable long form
           protein.
          Length = 579

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -3

Query: 435 LHSVLTFFTLFARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*LATSEVCLETEYE 256
           +HS+    T  AR  +    AV+      L+ +G+IE ++ +  S   A +E CL+ E E
Sbjct: 150 VHSMSVRLTCHARSMVSEYSAVSR---NSLKEMGEIEKLLMEKCSELSAVTERCLQVENE 206

Query: 255 HYIGSNLVHFGELLTDLG 202
           H + S      E L+ LG
Sbjct: 207 HVLKSMKACVSETLSMLG 224


>AB236158-1|BAE93463.1|  532|Homo sapiens Inscuteable short form
           protein.
          Length = 532

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -3

Query: 435 LHSVLTFFTLFARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*LATSEVCLETEYE 256
           +HS+    T  AR  +    AV+      L+ +G+IE ++ +  S   A +E CL+ E E
Sbjct: 103 VHSMSVRLTCHARSMVSEYSAVSR---NSLKEMGEIEKLLMEKCSELSAVTERCLQVENE 159

Query: 255 HYIGSNLVHFGELLTDLG 202
           H + S      E L+ LG
Sbjct: 160 HVLKSMKACVSETLSMLG 177


>AB231745-1|BAE17133.1|  532|Homo sapiens hypothetical protein
           protein.
          Length = 532

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = -3

Query: 435 LHSVLTFFTLFARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*LATSEVCLETEYE 256
           +HS+    T  AR  +    AV+      L+ +G+IE ++ +  S   A +E CL+ E E
Sbjct: 103 VHSMSVRLTCHARSMVSEYSAVSR---NSLKEMGEIEKLLMEKCSELSAVTERCLQVENE 159

Query: 255 HYIGSNLVHFGELLTDLG 202
           H + S      E L+ LG
Sbjct: 160 HVLKSMKACVSETLSMLG 177


>AB014597-1|BAA31672.2| 2486|Homo sapiens KIAA0697 protein protein.
          Length = 2486

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +1

Query: 307  ALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNR 429
            +++ + LDL K  E   RLA     EK++  R+++KE + R
Sbjct: 1340 SILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRR 1380


>AB007876-1|BAA24846.2|  529|Homo sapiens KIAA0416 protein.
          Length = 529

 Score = 30.3 bits (65), Expect = 6.3
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -1

Query: 311 KANPVDLPPPKFVLKPNTNTTSGVTLYIL-ASFSRISVLLTVGFPGCKTSQTICLRANNL 135
           K   + L   K    PNT  T  + L  L  SF+++S L    F G +  QT+ LR+N+L
Sbjct: 123 KLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSL 182

Query: 134 LVMNLRV 114
             + +R+
Sbjct: 183 RTIPVRL 189


>AY256461-1|AAP12522.1|  921|Homo sapiens zinc
           in-between-ring-finger ubiquitin-associated domain
           protein.
          Length = 921

 Score = 29.9 bits (64), Expect = 8.3
 Identities = 17/44 (38%), Positives = 20/44 (45%)
 Frame = -2

Query: 457 ISWYRGPSSFCSYVLYAVCAWASSSRTGRGGLTCAWARTSWPDR 326
           + W R   S  SYVL  V   A     G G  +C  AR +W DR
Sbjct: 370 LQWLR---SELSYVLEMVAELAGQQDPGLGAFSCQEARRAWLDR 410


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,999,547
Number of Sequences: 237096
Number of extensions: 2002464
Number of successful extensions: 5177
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 4915
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5169
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7310122300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -