SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M24194-1|AAA59626.1|  317|Homo sapiens MHC B complex protein 12....   186   4e-47
CR541909-1|CAG46707.1|  317|Homo sapiens GNB2L1 protein.              186   4e-47
CR456978-1|CAG33259.1|  317|Homo sapiens GNB2L1 protein.              186   4e-47
BC032006-1|AAH32006.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC021993-1|AAH21993.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC019362-1|AAH19362.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC019093-1|AAH19093.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC017287-1|AAH17287.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC014788-1|AAH14788.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC014256-1|AAH14256.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC010119-1|AAH10119.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC000366-1|AAH00366.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
BC000214-1|AAH00214.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
AY159316-1|AAO21313.1|  347|Homo sapiens lung cancer oncogene 7 ...   186   4e-47
AK222488-1|BAD96208.1|  317|Homo sapiens guanine nucleotide bind...   186   4e-47
CR457279-1|CAG33560.1|  330|Homo sapiens WDR5B protein.                67   5e-11
BC043494-1|AAH43494.1|  330|Homo sapiens WD repeat domain 5B pro...    67   5e-11
AK002149-1|BAA92110.1|  330|Homo sapiens protein ( Homo sapiens ...    67   5e-11
BX649632-1|CAI18774.1|  334|Homo sapiens WD repeat domain 5 prot...    63   9e-10
BC001635-1|AAH01635.1|  334|Homo sapiens WD repeat domain 5 prot...    63   9e-10
AK000552-1|BAA91248.1|  334|Homo sapiens protein ( Homo sapiens ...    63   9e-10
AJ011376-1|CAB66159.1|  362|Homo sapiens hypothetical protein pr...    63   9e-10
CR456762-1|CAG33043.1|  655|Homo sapiens KATNB1 protein.               58   3e-08
BT007022-1|AAP35668.1|  655|Homo sapiens katanin p80 (WD40-conta...    58   3e-08
BC001353-1|AAH01353.1|  655|Homo sapiens katanin p80 (WD repeat ...    58   3e-08
BC012352-1|AAH12352.1|  366|Homo sapiens WDR31 protein protein.        57   4e-08
AL449305-1|CAI10961.1|  367|Homo sapiens WD repeat domain 31 pro...    57   4e-08
AL137066-1|CAH70096.1|  367|Homo sapiens WD repeat domain 31 pro...    57   4e-08
AK093240-1|BAC04106.1|  367|Homo sapiens protein ( Homo sapiens ...    57   4e-08
AK127882-1|BAC87175.1|  369|Homo sapiens protein ( Homo sapiens ...    54   4e-07
EF011621-1|ABK41111.1|  357|Homo sapiens CDW11/WDR57 protein.          54   5e-07
BC001494-1|AAH01494.1|  357|Homo sapiens WD repeat domain 57 (U5...    54   5e-07
AL451070-1|CAH71848.1|  357|Homo sapiens WD repeat domain 57 (U5...    54   5e-07
AF090988-1|AAC69625.1|  357|Homo sapiens U5 snRNP-specific 40 kD...    54   5e-07
AF083383-1|AAC64084.1|  310|Homo sapiens 38kDa splicing factor p...    54   5e-07
AF052432-1|AAC09328.1|  655|Homo sapiens katanin p80 subunit pro...    54   5e-07
BC036377-1|AAH36377.1|  415|Homo sapiens WD repeat domain 69 pro...    53   7e-07
AK098821-1|BAC05425.1|  415|Homo sapiens protein ( Homo sapiens ...    53   7e-07
AK097409-1|BAC05039.1|  415|Homo sapiens protein ( Homo sapiens ...    53   7e-07
AC073065-2|AAX93215.1|  415|Homo sapiens unknown protein.              53   7e-07
BC012075-1|AAH12075.1|  485|Homo sapiens notchless homolog 1 (Dr...    52   1e-06
BC002884-1|AAH02884.2|  484|Homo sapiens NLE1 protein protein.         52   1e-06
AK001320-1|BAA91621.1|  485|Homo sapiens protein ( Homo sapiens ...    52   1e-06
AB209111-1|BAD92348.1|  487|Homo sapiens Notchless gene homolog ...    52   1e-06
U72342-1|AAC51111.1|  410|Homo sapiens platelet activating facto...    52   2e-06
L13387-1|AAA02882.1|  288|Homo sapiens Miller-Dieker lissencepha...    52   2e-06
L13386-1|AAA02881.1|  410|Homo sapiens Miller-Dieker lissencepha...    52   2e-06
L13385-1|AAA02880.1|  410|Homo sapiens Miller-Dieker lissencepha...    52   2e-06
BX538346-1|CAD98141.1|  147|Homo sapiens hypothetical protein pr...    52   2e-06
BC106004-1|AAI06005.1|  514|Homo sapiens pleiotropic regulator 1...    52   2e-06
BC064638-1|AAH64638.1|  410|Homo sapiens platelet-activating fac...    52   2e-06
BC020786-1|AAH20786.1|  505|Homo sapiens PLRG1 protein protein.        52   2e-06
AF400434-1|AAK92483.1|  410|Homo sapiens platelet-activating fac...    52   2e-06
AF208837-1|AAL34972.1|  410|Homo sapiens Miller-Dieker lissencep...    52   2e-06
AF044333-1|AAD09407.1|  514|Homo sapiens pleiotropic regulator 1...    52   2e-06
X70476-1|CAA49900.1|  906|Homo sapiens subunit of coatomer compl...    51   3e-06
BC000326-1|AAH00326.1|  906|Homo sapiens coatomer protein comple...    51   3e-06
AF208838-1|AAL34973.1|  410|Homo sapiens Miller-Dieker lissencep...    51   4e-06
BC025379-1|AAH25379.1|  571|Homo sapiens SPAG16 protein protein.       50   7e-06
AF490390-1|AAM97147.1|  631|Homo sapiens sperm-associated WD rep...    50   7e-06
AF310672-1|AAM63956.1|  631|Homo sapiens PF20 variant 1a protein.      50   7e-06
AC008169-1|AAX93092.1|  106|Homo sapiens unknown protein.              50   7e-06
BC015887-1|AAH15887.1|  404|Homo sapiens WD repeat and SOCS box-...    49   2e-05
AF229181-1|AAF71302.1|  404|Homo sapiens CS box-containing WD pr...    49   2e-05
AF163324-1|AAF80478.1|  404|Homo sapiens WSB-2 protein.                49   2e-05
AL607085-2|CAI15166.1|  494|Homo sapiens WD repeat domain 37 pro...    48   2e-05
AB023199-1|BAA76826.2|  502|Homo sapiens KIAA0982 protein protein.     48   2e-05
BC107125-1|AAI07126.1|  248|Homo sapiens WDR86 protein protein.        48   3e-05
BC047921-1|AAH47921.1|  563|Homo sapiens WDR86 protein protein.        48   3e-05
AK125347-1|BAC86140.1|  277|Homo sapiens protein ( Homo sapiens ...    48   3e-05
EF011613-1|ABK41103.1|  513|Homo sapiens CDW3/SMU1 protein.            48   4e-05
BC127949-1|AAI27950.1|  314|Homo sapiens WD repeat domain 38 pro...    48   4e-05
BC110654-1|AAI10655.1|  513|Homo sapiens smu-1 suppressor of mec...    48   4e-05
BC002876-1|AAH02876.1|  513|Homo sapiens smu-1 suppressor of mec...    48   4e-05
AL354928-6|CAI39637.1|  314|Homo sapiens WD repeat domain 38 pro...    48   4e-05
AL162590-6|CAI15554.1|  513|Homo sapiens smu-1 suppressor of mec...    48   4e-05
AK001667-1|BAA91822.1|  513|Homo sapiens protein ( Homo sapiens ...    48   4e-05
AF240696-1|AAF82746.1|  275|Homo sapiens WSB1 isoform 2 protein.       48   4e-05
Y14153-1|CAA74572.1|  569|Homo sapiens beta-transducin repeats c...    47   5e-05
BC027994-1|AAH27994.1|  605|Homo sapiens beta-transducin repeat ...    47   5e-05
BC026213-1|AAH26213.1|  529|Homo sapiens F-box and WD repeat dom...    47   5e-05
AL627424-18|CAI41043.1|  569|Homo sapiens beta-transducin repeat...    47   5e-05
AL627424-17|CAI41042.1|  605|Homo sapiens beta-transducin repeat...    47   5e-05
AL445463-3|CAI12964.1|  569|Homo sapiens beta-transducin repeat ...    47   5e-05
AL445463-2|CAI12963.1|  605|Homo sapiens beta-transducin repeat ...    47   5e-05
AL133387-2|CAH70019.1|  569|Homo sapiens beta-transducin repeat ...    47   5e-05
AL133387-1|CAH70020.1|  605|Homo sapiens beta-transducin repeat ...    47   5e-05
AF176022-1|AAF04528.1|  542|Homo sapiens F-box protein Fbw1b pro...    47   5e-05
AF129530-1|AAF04464.1|  569|Homo sapiens F-box protein Fbw1A pro...    47   5e-05
AF101784-1|AAD08702.1|  605|Homo sapiens b-TRCP variant E3RS-Ika...    47   5e-05
AB033281-1|BAA92331.1|  542|Homo sapiens F-box and WD-repeats pr...    47   5e-05
AB033280-1|BAA92330.1|  529|Homo sapiens F-box and WD-repeats pr...    47   5e-05
AB033279-1|BAA92329.1|  508|Homo sapiens F-box and WD-repeats pr...    47   5e-05
AB014596-1|BAA31671.1|  550|Homo sapiens KIAA0696 protein protein.     47   5e-05
EF011619-1|ABK41109.1|  478|Homo sapiens CDW9/WDR51B protein.          47   6e-05
EF011617-1|ABK41107.1|  423|Homo sapiens CDW7/WDR12 protein.           47   6e-05
BC026080-1|AAH26080.1|  478|Homo sapiens WD repeat domain 51B pr...    47   6e-05
BC008082-1|AAH08082.1|  423|Homo sapiens WD repeat domain 12 pro...    47   6e-05
AK074772-1|BAC11198.1|  478|Homo sapiens protein ( Homo sapiens ...    47   6e-05
AK022782-1|BAB14243.1|  423|Homo sapiens protein ( Homo sapiens ...    47   6e-05
AK022781-1|BAB14242.1|  423|Homo sapiens protein ( Homo sapiens ...    47   6e-05
AK001743-1|BAA91875.1|  423|Homo sapiens protein ( Homo sapiens ...    47   6e-05
AF242546-1|AAF60355.1|  423|Homo sapiens YTM1 protein.                 47   6e-05
AC010900-2|AAY24287.1|  423|Homo sapiens unknown protein.              47   6e-05
BC031227-1|AAH31227.2|  452|Homo sapiens WDR88 protein protein.        46   8e-05
AK131444-1|BAD18589.1|  472|Homo sapiens protein ( Homo sapiens ...    46   8e-05
AB010098-1|BAA36341.1|  475|Homo sapiens ClipinC protein.              46   8e-05
Y12781-1|CAA73319.1|  577|Homo sapiens transducin (beta) like 1 ...    46   1e-04
BC052304-1|AAH52304.1|  577|Homo sapiens transducin (beta)-like ...    46   1e-04
BC032708-1|AAH32708.1|  526|Homo sapiens TBL1X protein protein.        46   1e-04
BC021110-1|AAH21110.1|  421|Homo sapiens WD repeat and SOCS box-...    46   1e-04
BC005870-1|AAH05870.1|  315|Homo sapiens mitogen-activated prote...    46   1e-04
AK223195-1|BAD96915.1|  315|Homo sapiens mitogen-activated prote...    46   1e-04
AK222721-1|BAD96441.1|  579|Homo sapiens pre-mRNA splicing facto...    46   1e-04
AK074917-1|BAC11291.1|  421|Homo sapiens protein ( Homo sapiens ...    46   1e-04
AF112205-1|AAF17193.1|  421|Homo sapiens WSB-1 protein protein.        46   1e-04
AF072880-1|AAD28808.1|  421|Homo sapiens SOCS box-containing WD ...    46   1e-04
AF069313-1|AAD20954.2|  421|Homo sapiens WSB1 protein protein.         46   1e-04
AB209608-1|BAD92845.1|  540|Homo sapiens transducin beta-like 1X...    46   1e-04
BC126114-1|AAI26115.1|  579|Homo sapiens cell division cycle 40 ...    46   1e-04
BC117145-1|AAI17146.1|  579|Homo sapiens cell division cycle 40 ...    46   1e-04
BC026335-1|AAH26335.1|  475|Homo sapiens coronin, actin binding ...    46   1e-04
AL671518-2|CAI13322.1|  579|Homo sapiens cell division cycle 40 ...    46   1e-04
AL671518-1|CAI13321.1|  539|Homo sapiens cell division cycle 40 ...    46   1e-04
AL445068-1|CAI22519.1|  539|Homo sapiens cell division cycle 40 ...    46   1e-04
AF061241-1|AAC25166.1|  542|Homo sapiens splicing factor hPRP17 ...    46   1e-04
AF038392-1|AAC39730.1|  579|Homo sapiens pre-mRNA splicing facto...    46   1e-04
AB208903-1|BAD92140.1|  501|Homo sapiens pre-mRNA splicing facto...    46   1e-04
AB023142-1|BAA76769.1|  479|Homo sapiens KIAA0925 protein protein.     46   1e-04
BC130473-1|AAI30474.1|  522|Homo sapiens transducin (beta)-like ...    45   2e-04
BC130471-1|AAI30472.1|  522|Homo sapiens transducin (beta)-like ...    45   2e-04
AY336089-1|AAR24619.1|  271|Homo sapiens proliferation-inducing ...    45   2e-04
AF332222-1|AAK13474.1|  522|Homo sapiens transducin beta-like 1 ...    45   2e-04
AF332221-1|AAK13473.1|  522|Homo sapiens transducin beta-like 1 ...    45   2e-04
AF332220-1|AAK13472.1|  522|Homo sapiens transducin beta-like 1 ...    45   2e-04
AL121990-7|CAI22015.1|  589|Homo sapiens TAF5-like RNA polymeras...    45   3e-04
AJ009770-1|CAA08816.1|  260|Homo sapiens putative transcription ...    45   3e-04
AF069736-1|AAC39906.1|  589|Homo sapiens PCAF associated factor ...    45   3e-04
BT020045-1|AAV38848.1|  350|Homo sapiens unr-interacting protein...    44   3e-04
BT020044-1|AAV38847.1|  350|Homo sapiens unr-interacting protein...    44   3e-04
BC117246-1|AAI17247.1|  707|Homo sapiens F-box and WD repeat dom...    44   3e-04
BC117244-1|AAI17245.1|  707|Homo sapiens F-box and WD repeat dom...    44   3e-04
BC062306-1|AAH62306.1|  350|Homo sapiens serine/threonine kinase...    44   3e-04
BC037320-1|AAH37320.1|  621|Homo sapiens FBXW7 protein protein.        44   3e-04
BC002342-1|AAH02342.1|  474|Homo sapiens coronin, actin binding ...    44   3e-04
BC000162-1|AAH00162.1|  350|Homo sapiens serine/threonine kinase...    44   3e-04
AY049984-1|AAL07271.1|  707|Homo sapiens F-box protein CDC4 prot...    44   3e-04
AY049776-1|AAL15433.1|  350|Homo sapiens unr-interacting protein...    44   3e-04
AY033553-1|AAK57547.1|  627|Homo sapiens F-box protein FBW7 prot...    44   3e-04
AY008274-1|AAG16640.1|  589|Homo sapiens F-box protein SEL10 pro...    44   3e-04
AL162070-1|CAB82406.1|  495|Homo sapiens hypothetical protein pr...    44   3e-04
AK223449-1|BAD97169.1|  627|Homo sapiens F-box protein FBW7 isof...    44   3e-04
AK001933-1|BAA91986.1|  553|Homo sapiens protein ( Homo sapiens ...    44   3e-04
AJ010025-1|CAB38041.1|  350|Homo sapiens unr-interacting protein...    44   3e-04
AJ005257-1|CAA06444.1|   86|Homo sapiens protein ( Homo sapiens ...    44   3e-04
AF411972-1|AAL06291.1|  627|Homo sapiens archipelago beta form p...    44   3e-04
AF411971-1|AAL06290.1|  707|Homo sapiens archipelago alpha form ...    44   3e-04
AF383178-1|AAK60269.1|  561|Homo sapiens F-box protein FBX30 pro...    44   3e-04
AF106683-1|AAD43036.1|  421|Homo sapiens WSB-1 protein.                44   3e-04
AB209909-1|BAD93146.1|  501|Homo sapiens coronin, actin binding ...    44   3e-04
AB209725-1|BAD92962.1|  624|Homo sapiens F-box protein FBW7 isof...    44   3e-04
AB030656-1|BAA83077.1|  474|Homo sapiens hCRNN4 protein.               44   3e-04
AB024327-1|BAA75544.1|  350|Homo sapiens WD-40 repeat protein pr...    44   3e-04
BC026353-1|AAH26353.1|  677|Homo sapiens WD repeat domain 48 pro...    44   4e-04
BC023662-1|AAH23662.2|  475|Homo sapiens RRP9, small subunit (SS...    44   4e-04
BC010048-1|AAH10048.1|  475|Homo sapiens RRP9, small subunit (SS...    44   4e-04
BC009879-1|AAH09879.1|  475|Homo sapiens RRP9, small subunit (SS...    44   4e-04
BC001113-1|AAH01113.1|  475|Homo sapiens RRP9, small subunit (SS...    44   4e-04
AJ001340-1|CAA04687.1|  475|Homo sapiens U3 snoRNP associated 55...    44   4e-04
AF492460-1|AAN64030.1| 1322|Homo sapiens WD repeat 17 protein.         44   4e-04
AF468833-1|AAL78650.1|  677|Homo sapiens WD repeat endosomal pro...    44   4e-04
AF332505-1|AAK97355.1|  756|Homo sapiens apoptosis-inhibitor-lik...    44   4e-04
AB040882-1|BAA95973.2|  680|Homo sapiens KIAA1449 protein protein.     44   4e-04
BC126381-1|AAI26382.1|  848|Homo sapiens WD repeat domain 78 pro...    44   6e-04
BC126379-1|AAI26380.1|  848|Homo sapiens WD repeat domain 78 pro...    44   6e-04
BC119692-1|AAI19693.1|  407|Homo sapiens WD repeat domain 51A pr...    44   6e-04
BC113421-1|AAI13422.1|  514|Homo sapiens transducin (beta)-like ...    44   6e-04
BC110877-1|AAI10878.1|  359|Homo sapiens WDR51A protein protein.       44   6e-04
AL592161-2|CAH72705.1|  848|Homo sapiens WD repeat domain 78 pro...    44   6e-04
AL354978-2|CAH71842.1|  848|Homo sapiens WD repeat domain 78 pro...    44   6e-04
AL139216-3|CAI18872.1|  848|Homo sapiens WD repeat domain 78 pro...    44   6e-04
AK223073-1|BAD96793.1|  474|Homo sapiens coronin, actin binding ...    44   6e-04
AK075289-1|BAC11525.1|  407|Homo sapiens protein ( Homo sapiens ...    44   6e-04
AK022956-1|BAB14331.1|  514|Homo sapiens protein ( Homo sapiens ...    44   6e-04
AF314544-1|AAK00301.1|  514|Homo sapiens nuclear receptor co-rep...    44   6e-04
AF268193-1|AAG44736.1|  514|Homo sapiens IRA1 protein.                 44   6e-04
X89109-1|CAA61482.1|  461|Homo sapiens coronin homologue protein.      43   8e-04
U34690-1|AAA77058.1|  461|Homo sapiens coronin-like protein prot...    43   8e-04
D44497-1|BAA07940.1|  461|Homo sapiens human p57 protein.              43   8e-04
BC126387-1|AAI26388.1|  461|Homo sapiens coronin, actin binding ...    43   8e-04
BC126385-1|AAI26386.1|  461|Homo sapiens coronin, actin binding ...    43   8e-04
BC119693-1|AAI19694.1|  441|Homo sapiens WDR51A protein protein.       43   8e-04
BC110374-1|AAI10375.1|  461|Homo sapiens coronin, actin binding ...    43   8e-04
AK222576-1|BAD96296.1|  421|Homo sapiens WD SOCS-box protein 1 i...    43   8e-04
AF495470-1|AAM18516.1|  461|Homo sapiens tryptophane aspartate-c...    43   8e-04
U24105-1|AAB70879.1| 1224|Homo sapiens coatomer protein protein.       43   0.001
BC038447-1|AAH38447.1| 1233|Homo sapiens COPA protein protein.         43   0.001
BC007417-1|AAH07417.2|  396|Homo sapiens WDR51A protein protein.       43   0.001
AL513282-3|CAI12455.1| 1233|Homo sapiens coatomer protein comple...    43   0.001
AL513282-2|CAI12454.1| 1224|Homo sapiens coatomer protein comple...    43   0.001
AL445230-2|CAI15004.1| 1233|Homo sapiens coatomer protein comple...    43   0.001
AL445230-1|CAI15005.1| 1224|Homo sapiens coatomer protein comple...    43   0.001
BX538087-1|CAD98010.1|  913|Homo sapiens hypothetical protein pr...    42   0.001
BX537578-1|CAD97788.1|  913|Homo sapiens hypothetical protein pr...    42   0.001
BC028697-1|AAH28697.3|  913|Homo sapiens WD repeat domain 44 pro...    42   0.001
BC028364-1|AAH28364.1| 1061|Homo sapiens FBXW10 protein protein.       42   0.001
BC013997-1|AAH13997.1|  353|Homo sapiens guanine nucleotide bind...    42   0.001
AY729024-1|AAU43731.1| 1052|Homo sapiens ubiquitin ligase specif...    42   0.001
AL834210-1|CAD38894.1|  805|Homo sapiens hypothetical protein pr...    42   0.001
AL391830-2|CAI41512.1|  913|Homo sapiens WD repeat domain 44 pro...    42   0.001
AL391830-1|CAI41513.1|  905|Homo sapiens WD repeat domain 44 pro...    42   0.001
AL391803-3|CAI41482.1|  913|Homo sapiens WD repeat domain 44 pro...    42   0.001
AL391803-2|CAI41483.1|  905|Homo sapiens WD repeat domain 44 pro...    42   0.001
AL391803-1|CAI41481.1|  805|Homo sapiens WD repeat domain 44 pro...    42   0.001
AL391474-2|CAI41402.1|  913|Homo sapiens WD repeat domain 44 pro...    42   0.001
AL391474-1|CAI41403.1|  905|Homo sapiens WD repeat domain 44 pro...    42   0.001
AK127556-1|BAC87033.1|  429|Homo sapiens protein ( Homo sapiens ...    42   0.001
AK092077-1|BAC03799.1|  616|Homo sapiens protein ( Homo sapiens ...    42   0.001
AF501885-1|AAM15921.1|  353|Homo sapiens guanine nucleotide bind...    42   0.001
AF300650-1|AAG18444.1|  395|Homo sapiens guanine nucleotide bind...    42   0.001
AF017656-1|AAC63826.1|  353|Homo sapiens G protein beta 5 subuni...    42   0.001
AB209899-1|BAD93136.1|  967|Homo sapiens Hypothetical protein DK...    42   0.001
U82756-1|AAC02261.1|  520|Homo sapiens WD splicing factor Hprp4p...    42   0.002
CR457105-1|CAG33386.1|  521|Homo sapiens PRPF4 protein.                42   0.002
BC117291-1|AAI17292.1|  925|Homo sapiens coronin 7 protein.            42   0.002
BC117289-1|AAI17290.1|  925|Homo sapiens coronin 7 protein.            42   0.002
BC037168-1|AAH37168.1|  502|Homo sapiens WDR48 protein protein.        42   0.002
BC007424-1|AAH07424.1|  521|Homo sapiens PRP4 pre-mRNA processin...    42   0.002
BC006449-1|AAH06449.1|  489|Homo sapiens coronin, actin binding ...    42   0.002
BC001588-1|AAH01588.1|  522|Homo sapiens PRP4 pre-mRNA processin...    42   0.002
AY572489-1|AAS78572.1|  521|Homo sapiens 60 kDa U4/U6 snRNP-spec...    42   0.002
AL449305-8|CAI10969.1|  521|Homo sapiens PRP4 pre-mRNA processin...    42   0.002
AL449305-7|CAI10968.1|  522|Homo sapiens PRP4 pre-mRNA processin...    42   0.002
AK025674-1|BAB15211.1|  925|Homo sapiens protein ( Homo sapiens ...    42   0.002
AF016369-1|AAC51925.1|  522|Homo sapiens U4/U6 small nuclear rib...    42   0.002
AF001687-1|AAB87640.1|  521|Homo sapiens U4/U6 snRNP 60 kDa prot...    42   0.002
AB209797-1|BAD93034.1|  537|Homo sapiens PRPF4 protein variant p...    42   0.002
AB209579-1|BAD92816.1|  287|Homo sapiens coronin, actin binding ...    42   0.002
X95525-1|CAA64777.1|  799|Homo sapiens hTAFII100 protein.              42   0.002
U80191-1|AAC51215.1|  800|Homo sapiens TFIID subunit TAFII100 pr...    42   0.002
U75309-1|AAC50902.1|  801|Homo sapiens TBP-associated factor pro...    42   0.002
M36429-1|AAA63264.1|  340|Homo sapiens protein ( Human transduci...    42   0.002
M16514-1|AAA03179.1|  340|Homo sapiens GNB2 protein.                   42   0.002
EF079890-1|ABN48555.1|  444|Homo sapiens ATG16 autophagy related...    42   0.002
EF079889-1|ABN48554.1|  588|Homo sapiens ATG16 autophagy related...    42   0.002
CR541729-1|CAG46530.1|  340|Homo sapiens GNB2 protein.                 42   0.002
BC117337-1|AAI17338.1|  523|Homo sapiens ATG16L1 protein protein.      42   0.002
BC071846-1|AAH71846.1|  475|Homo sapiens ATG16L1 protein protein.      42   0.002
BC068003-1|AAH68003.1|  340|Homo sapiens guanine nucleotide bind...    42   0.002
BC052268-1|AAH52268.2|  800|Homo sapiens TAF5 RNA polymerase II,...    42   0.002
BC012348-1|AAH12348.1|  340|Homo sapiens guanine nucleotide bind...    42   0.002
BC010073-1|AAH10073.1|  340|Homo sapiens guanine nucleotide bind...    42   0.002
AY398617-1|AAR32130.1|  607|Homo sapiens APG16L beta protein.          42   0.002
AY358182-1|AAQ88549.1|  470|Homo sapiens SSGL9393 protein.             42   0.002
AL591408-4|CAI16747.1|  800|Homo sapiens TAF5 RNA polymerase II,...    42   0.002
AK223615-1|BAD97335.1|  803|Homo sapiens Transcription initiatio...    42   0.002
AK027854-1|BAB55412.1|  504|Homo sapiens protein ( Homo sapiens ...    42   0.002
AF501883-1|AAM15919.1|  340|Homo sapiens guanine nucleotide bind...    42   0.002
AF053356-4|AAC78794.1|  340|Homo sapiens GNB2 protein.                 42   0.002
AC013726-3|AAY14860.1|  523|Homo sapiens unknown protein.              42   0.002
EF560734-1|ABQ59044.1|  588|Homo sapiens ATG16L1 protein protein.      41   0.003
BC060874-1|AAH60874.2|  973|Homo sapiens NBEAL2 protein protein.       41   0.003
AY358455-1|AAQ88820.1| 1003|Homo sapiens SQFE253 protein.              41   0.003
AK131104-1|BAC85154.1| 2760|Homo sapiens FLJ00341 protein protein.     41   0.003
AK074891-1|BAC11271.1|  242|Homo sapiens protein ( Homo sapiens ...    41   0.003
AK074434-1|BAB85082.1|  293|Homo sapiens protein ( Homo sapiens ...    41   0.003
AB011112-1|BAA25466.3| 2041|Homo sapiens KIAA0540 protein protein.     41   0.003
U02609-1|AAA18945.1|  519|Homo sapiens transducin-like protein p...    41   0.004
BC035409-1|AAH35409.1|  808|Homo sapiens transducin (beta)-like ...    41   0.004
BC014007-1|AAH14007.1|  808|Homo sapiens TBL3 protein protein.         41   0.004
BC010231-1|AAH10231.1|  808|Homo sapiens transducin (beta)-like ...    41   0.004
AY172970-1|AAO45288.1|  974|Homo sapiens beach protein protein.        41   0.004
AK128636-1|BAC87543.1| 1042|Homo sapiens protein ( Homo sapiens ...    41   0.004
AB209173-1|BAD92410.1|  832|Homo sapiens transducin beta-like 3 ...    41   0.004
X89887-1|CAA61979.1| 1017|Homo sapiens HIRA protein.                   40   0.005
X81844-1|CAA57436.1| 1017|Homo sapiens HIRA protein.                   40   0.005
X77633-1|CAA54721.1|  973|Homo sapiens HIRAHs protein.                 40   0.005
X75296-1|CAA53044.1|  766|Homo sapiens TUP1 like enhancer of SPL...    40   0.005
CR456503-1|CAG30389.1| 1017|Homo sapiens HIRA protein.                 40   0.005
BC039835-1|AAH39835.1| 1017|Homo sapiens HIR histone cell cycle ...    40   0.005
BC032721-1|AAH32721.1|  643|Homo sapiens HIRA protein protein.         40   0.005
BC024267-1|AAH24267.1|  594|Homo sapiens TRAF7 protein protein.        40   0.005
AY569455-1|AAS68363.1|  670|Homo sapiens TRAF7 protein.                40   0.005
X04526-2|CAA28207.1|  340|Homo sapiens protein ( Human liver mRN...    40   0.007
U39067-1|AAC97144.1|  325|Homo sapiens translation initiation fa...    40   0.007
U36764-1|AAC50224.1|  325|Homo sapiens TGF-beta receptor interac...    40   0.007
M36430-1|AAA63265.1|  247|Homo sapiens protein ( Human transduci...    40   0.007
CR456784-1|CAG33065.1|  340|Homo sapiens GNB1 protein.                 40   0.007
BX679664-5|CAH71325.1|  891|Homo sapiens WD repeat domain 47 pro...    40   0.007
BX679664-4|CAH71327.1|  919|Homo sapiens WD repeat domain 47 pro...    40   0.007
BX679664-3|CAH71326.1|  920|Homo sapiens WD repeat domain 47 pro...    40   0.007
BT019597-1|AAV38404.1|  325|Homo sapiens eukaryotic translation ...    40   0.007
BT007305-1|AAP35969.1|  340|Homo sapiens guanine nucleotide bind...    40   0.007
BC114618-1|AAI14619.1|  332|Homo sapiens GNB1 protein protein.         40   0.007
BC108280-1|AAI08281.1|  896|Homo sapiens echinoderm microtubule ...    40   0.007
BC039254-1|AAH39254.1|  893|Homo sapiens WDR47 protein protein.        40   0.007
BC016946-1|AAH16946.1|  342|Homo sapiens WD repeat domain 77 pro...    40   0.007
BC011778-1|AAH11778.1|  342|Homo sapiens WD repeat domain 77 pro...    40   0.007
BC009411-1|AAH09411.1|  330|Homo sapiens WDR77 protein protein.        40   0.007
BC008991-1|AAH08991.1|  340|Homo sapiens guanine nucleotide bind...    40   0.007
BC006477-1|AAH06477.1|  342|Homo sapiens WD repeat domain 77 pro...    40   0.007
BC005888-1|AAH05888.1|  340|Homo sapiens guanine nucleotide bind...    40   0.007
BC004186-1|AAH04186.1|  340|Homo sapiens guanine nucleotide bind...    40   0.007
BC003140-1|AAH03140.1|  325|Homo sapiens eukaryotic translation ...    40   0.007
BC001679-1|AAH01679.1|  342|Homo sapiens WD repeat domain 77 pro...    40   0.007
BC000413-1|AAH00413.1|  325|Homo sapiens eukaryotic translation ...    40   0.007
AY225316-1|AAP79114.1|  342|Homo sapiens androgen receptor cofac...    40   0.007
AL449266-4|CAI14352.1|  891|Homo sapiens WD repeat domain 47 pro...    40   0.007
AL449266-3|CAI14353.1|  919|Homo sapiens WD repeat domain 47 pro...    40   0.007
AL449266-2|CAI14351.1|  920|Homo sapiens WD repeat domain 47 pro...    40   0.007
AL390195-6|CAC36041.1|  342|Homo sapiens MEP50 protein (MEP50) p...    40   0.007
AL390195-5|CAI15627.1|  290|Homo sapiens MEP50 protein (MEP50) p...    40   0.007
AL121991-4|CAI22322.1|  325|Homo sapiens eukaryotic translation ...    40   0.007
AL109917-5|CAI95654.1|  340|Homo sapiens guanine nucleotide bind...    40   0.007
AL049795-11|CAI22062.1|  125|Homo sapiens eukaryotic translation...    40   0.007
AL049795-10|CAI22061.1|  325|Homo sapiens eukaryotic translation...    40   0.007
AL031282-2|CAI20029.1|  340|Homo sapiens guanine nucleotide bind...    40   0.007
AK223189-1|BAD96909.1|  342|Homo sapiens methylosome protein 50 ...    40   0.007
AK128679-1|BAC87566.1|  780|Homo sapiens protein ( Homo sapiens ...    40   0.007
AK093146-1|BAC04073.1|  889|Homo sapiens protein ( Homo sapiens ...    40   0.007
AF501882-1|AAM15918.1|  340|Homo sapiens guanine nucleotide bind...    40   0.007
AF478464-1|AAL79917.1|  342|Homo sapiens MEP50 protein protein.        40   0.007
AB073603-1|BAD38641.1|  342|Homo sapiens putative protein produc...    40   0.007
AB020700-1|BAA74916.2|  974|Homo sapiens KIAA0893 protein protein.     40   0.007
U20980-1|AAA76737.1|  559|Homo sapiens chromatin assembly factor...    40   0.010
M16538-1|AAA35922.1|  340|Homo sapiens protein ( Human signal-tr...    40   0.010
BC021218-1|AAH21218.1|  559|Homo sapiens chromatin assembly fact...    40   0.010
AP001725-3|BAA95549.1|  559|Homo sapiens chromatin assembly fact...    40   0.010
AP000694-1|BAA89426.1|  559|Homo sapiens chromatin assembly fact...    40   0.010
AK222483-1|BAD96203.1|  325|Homo sapiens eukaryotic translation ...    40   0.010
BC034964-1|AAH34964.1|  920|Homo sapiens WD repeat domain 47 pro...    39   0.013
BC010080-1|AAH10080.1|  305|Homo sapiens WD repeat domain 61 pro...    39   0.013
AK024754-1|BAB14986.1|  305|Homo sapiens protein ( Homo sapiens ...    39   0.013
AF309553-1|AAG31639.1|  305|Homo sapiens meiotic recombination p...    39   0.013
AF100786-1|AAP97225.1|  305|Homo sapiens G protein beta subunit-...    39   0.013
U86136-1|AAC51107.1| 2627|Homo sapiens telomerase-associated pro...    39   0.017
CR457269-1|CAG33550.1|  826|Homo sapiens STATIP1 protein.              39   0.017
BC126107-1|AAI26108.1| 2627|Homo sapiens telomerase-associated p...    39   0.017
BC032553-1|AAH32553.1|  756|Homo sapiens ELP2 protein protein.         39   0.017
BC001648-1|AAH01648.1|  432|Homo sapiens WD repeat domain 18 pro...    39   0.017
BC000040-1|AAH00040.2|  432|Homo sapiens WD repeat domain 18 pro...    39   0.017
AY736034-1|AAU50678.1|  478|Homo sapiens F-box and WD-40 repeat ...    39   0.017
AK222791-1|BAD96511.1|  826|Homo sapiens elongator protein 2 var...    39   0.017
AK131383-1|BAD18534.1|  141|Homo sapiens protein ( Homo sapiens ...    39   0.017
AK127772-1|BAC87125.1| 1314|Homo sapiens protein ( Homo sapiens ...    39   0.017
AK123625-1|BAC85666.1|  129|Homo sapiens protein ( Homo sapiens ...    39   0.017
AK022709-1|BAB14193.1|  800|Homo sapiens protein ( Homo sapiens ...    39   0.017
AK001741-1|BAA91874.1|  826|Homo sapiens protein ( Homo sapiens ...    39   0.017
AF403223-1|AAQ03093.1|  705|Homo sapiens SHINC-2 protein.              39   0.017
AC004528-1|AAC12679.1|  431|Homo sapiens R32184_1 protein.             39   0.017
AB209669-1|BAD92906.1| 1903|Homo sapiens Telomerase protein comp...    39   0.017
AB053276-1|BAB69430.1|  348|Homo sapiens TUWD12 protein.               39   0.017
AB053266-1|BAB69057.1|  348|Homo sapiens TUWD12 protein.               39   0.017
Y12050-1|CAA72779.1|  340|Homo sapiens guanine nucleotide-bindin...    38   0.022
U47924-5|AAB51313.1|  340|Homo sapiens G-protein beta-3 chain pr...    38   0.022
M31328-1|AAA52582.1|  340|Homo sapiens GNB3 protein.                   38   0.022
CR457333-1|CAG33614.1|  305|Homo sapiens REC14 protein.                38   0.022
BT009800-1|AAP88802.1|  340|Homo sapiens guanine nucleotide bind...    38   0.022
BC117698-1|AAI17699.1| 1358|Homo sapiens NWD1 protein protein.         38   0.022
BC015920-1|AAH15920.1|  297|Homo sapiens GNB3 protein protein.         38   0.022
BC002454-1|AAH02454.1|  340|Homo sapiens guanine nucleotide bind...    38   0.022
BC000115-1|AAH00115.1|  340|Homo sapiens guanine nucleotide bind...    38   0.022
AY631872-1|AAT38116.1|  340|Homo sapiens guanine nucleotide bind...    38   0.022
AK001978-1|BAA92015.1|  428|Homo sapiens protein ( Homo sapiens ...    38   0.022
AF501884-1|AAM15920.1|  340|Homo sapiens guanine nucleotide bind...    38   0.022
AB209283-1|BAD92520.1|  327|Homo sapiens guanine nucleotide-bind...    38   0.022
U63810-1|AAC24948.1|  339|Homo sapiens WD40 protein Ciao 1 protein.    38   0.038
L07758-1|AAA65201.1|  501|Homo sapiens IEF SSP 9502 protein.           38   0.038
EF011618-1|ABK41108.1|  339|Homo sapiens CDW8/WDR39 protein.           38   0.038
EF011612-1|ABK41102.1|  514|Homo sapiens CDW2/WDR26 protein.           38   0.038
CR456802-1|CAG33083.1|  339|Homo sapiens CIAO1 protein.                38   0.038
BC106879-1|AAI06880.1|  731|Homo sapiens STRN protein protein.         38   0.038
BC106878-1|AAI06879.1|  755|Homo sapiens STRN protein protein.         38   0.038
BC063817-1|AAH63817.1|  404|Homo sapiens WDR26 protein protein.        38   0.038
BC052301-1|AAH52301.2|  514|Homo sapiens WD repeat domain 26 pro...    38   0.038
BC036713-1|AAH36713.1|  542|Homo sapiens ATG16L2 protein protein.      38   0.038
BC032812-1|AAH32812.1|  339|Homo sapiens cytosolic iron-sulfur p...    38   0.038
BC031471-1|AAH31471.2|  373|Homo sapiens WDR26 protein protein.        38   0.038
BC001652-1|AAH01652.1|  501|Homo sapiens PWP1 homolog (S. cerevi...    38   0.038
BC001395-1|AAH01395.1|  339|Homo sapiens cytosolic iron-sulfur p...    38   0.038
AY304473-1|AAQ74770.1|  514|Homo sapiens WD40 repeat protein 26 ...    38   0.038
AY221751-1|AAO67709.1|  498|Homo sapiens myocardial ischemic pre...    38   0.038
AK223257-1|BAD96977.1|  339|Homo sapiens WD40 protein Ciao1 vari...    38   0.038
AK223162-1|BAD96882.1|  501|Homo sapiens nuclear phosphoprotein ...    38   0.038
AK093017-1|BAC04021.1|  619|Homo sapiens protein ( Homo sapiens ...    38   0.038
AK090597-1|BAC03485.1|  513|Homo sapiens protein ( Homo sapiens ...    38   0.038
AK024669-1|BAB14955.1|  367|Homo sapiens protein ( Homo sapiens ...    38   0.038
AJ223814-1|CAA11560.1|  780|Homo sapiens striatin protein.             38   0.038
AC007382-1|AAF66162.1|  616|Homo sapiens unknown protein.              38   0.038
AC004020-1|AAC23493.1|  339|Homo sapiens Unknown gene product pr...    38   0.038
AB209887-1|BAD93124.1|  725|Homo sapiens WD repeat domain 26 var...    38   0.038
EF036494-1|ABO65080.1|  177|Homo sapiens SEC13-like 1 isoform pr...    37   0.051
BC091506-1|AAH91506.1|  322|Homo sapiens SEC13 homolog (S. cerev...    37   0.051
BC002634-1|AAH02634.2|  325|Homo sapiens SEC13 homolog (S. cerev...    37   0.051
AY295082-1|AAQ63174.1|  544|Homo sapiens pre-mRNA splicing facto...    37   0.051
AK223019-1|BAD96739.1|  322|Homo sapiens SEC13-like 1 isoform b ...    37   0.051
AK123876-1|BAC85713.1|  428|Homo sapiens protein ( Homo sapiens ...    37   0.051
AK074217-1|BAB85020.1|  506|Homo sapiens protein ( Homo sapiens ...    37   0.051
AB209554-1|BAD92791.1|  303|Homo sapiens SEC13-like 1 isoform b ...    37   0.051
X72841-1|CAA51360.1|  425|Homo sapiens IEF 7442 protein.               37   0.067
U90651-1|AAD08714.1|  441|Homo sapiens embryonic ectoderm develo...    37   0.067
U88871-1|AAC51238.1|  323|Homo sapiens HsPex7p protein.                37   0.067
U76560-1|AAB50556.1|  323|Homo sapiens peroxisome targeting sign...    37   0.067
U35143-1|AAC50231.1|  425|Homo sapiens retinoblastoma-binding pr...    37   0.067
U28413-1|AAA82605.1|  396|Homo sapiens CSA protein protein.            37   0.067
CR542076-1|CAG46873.1|  323|Homo sapiens PEX7 protein.                 37   0.067
CR542054-1|CAG46851.1|  323|Homo sapiens PEX7 protein.                 37   0.067
CR541701-1|CAG46502.1|  425|Homo sapiens RBBP7 protein.                37   0.067
CR536563-1|CAG38800.1|  396|Homo sapiens CKN1 protein.                 37   0.067
BT020021-1|AAV38824.1|  396|Homo sapiens Cockayne syndrome 1 (cl...    37   0.067
BC114501-1|AAI14502.1|  425|Homo sapiens retinoblastoma binding ...    37   0.067
BC114500-1|AAI14501.1|  425|Homo sapiens retinoblastoma binding ...    37   0.067
BC068995-1|AAH68995.1|  466|Homo sapiens EED protein protein.          37   0.067
BC067132-1|AAH67132.1|  546|Homo sapiens WDR23 protein protein.        37   0.067
BC047672-1|AAH47672.1|  427|Homo sapiens EED protein protein.          37   0.067
BC031606-1|AAH31606.1|  280|Homo sapiens PEX7 protein protein.         37   0.067
BC006268-1|AAH06268.1|  323|Homo sapiens peroxisomal biogenesis ...    37   0.067
BC000873-1|AAH00873.1|  340|Homo sapiens guanine nucleotide bind...    37   0.067
AY213194-1|AAO21128.1|  396|Homo sapiens Cockayne syndrome 1 (cl...    37   0.067
AL929302-6|CAI41284.1|  420|Homo sapiens retinoblastoma binding ...    37   0.067
AL929302-5|CAI41283.1|  469|Homo sapiens retinoblastoma binding ...    37   0.067
AL929302-3|CAI41281.1|  175|Homo sapiens retinoblastoma binding ...    37   0.067
AL833831-1|CAD38691.1|  295|Homo sapiens hypothetical protein pr...    37   0.067
AL365223-4|CAI15714.1|  323|Homo sapiens peroxisomal biogenesis ...    37   0.067
AL121993-4|CAI22739.1|  943|Homo sapiens WD repeat domain 3 prot...    37   0.067
AL121933-2|CAI15471.1|  323|Homo sapiens peroxisomal biogenesis ...    37   0.067
AK074296-1|BAB85041.1|  546|Homo sapiens protein ( Homo sapiens ...    37   0.067
AF300648-1|AAG18442.1|  340|Homo sapiens guanine nucleotide bind...    37   0.067
AF267858-1|AAG44727.1|  548|Homo sapiens GL014 protein.                37   0.067
AF180814-1|AAF37350.1|  323|Homo sapiens peroxisomal PTS2 recept...    37   0.067
AF099032-1|AAD08815.1|  400|Homo sapiens embryonic ectoderm deve...    37   0.067
AF083217-1|AAD45865.1|  943|Homo sapiens WD repeat protein WDR3 ...    37   0.067
AF080227-1|AAC95144.1|  441|Homo sapiens embryonic ectoderm deve...    37   0.067
AF078933-1|AAC68675.1|  427|Homo sapiens WAIT-1 protein.               37   0.067
AF070603-1|AAC28655.1|  207|Homo sapiens beta-subunit signal tra...    37   0.067
AF070418-1|AAC23685.1|  517|Homo sapiens embryonic ectoderm deve...    37   0.067
AB209073-1|BAD92310.1|  469|Homo sapiens WD repeat domain 23 iso...    37   0.067
D50914-1|BAA09473.1|  682|Homo sapiens KIAA0124 protein.               36   0.089
BC133025-1|AAI33026.1|  951|Homo sapiens WD repeat domain 36 pro...    36   0.089
BC113669-1|AAI13670.1|  777|Homo sapiens intraflagellar transpor...    36   0.089
BC101494-1|AAI01495.1|  777|Homo sapiens intraflagellar transpor...    36   0.089
BC098446-1|AAH98446.1|  567|Homo sapiens BOP1 protein protein.         36   0.089
BC073813-1|AAH73813.1|  521|Homo sapiens BOP1 protein protein.         36   0.089
BC047574-1|AAH47574.1|  899|Homo sapiens WDFY4 protein protein.        36   0.089
BC032551-1|AAH32551.1|  795|Homo sapiens phospholipase A2-activa...    36   0.089
BC032420-1|AAH32420.1|  322|Homo sapiens WDFY4 protein protein.        36   0.089
BC017674-1|AAH17674.1|  746|Homo sapiens block of proliferation ...    36   0.089
BC015694-1|AAH15694.2|  320|Homo sapiens WDFY4 protein protein.        36   0.089
BC013980-1|AAH13980.1|  746|Homo sapiens block of proliferation ...    36   0.089
BC013787-1|AAH13787.1|  746|Homo sapiens block of proliferation ...    36   0.089
BC007274-1|AAH07274.1|  733|Homo sapiens Similar to block of pro...    36   0.089
BC005160-1|AAH05160.2|  686|Homo sapiens BOP1 protein protein.         36   0.089
BC001086-1|AAH01086.2|  677|Homo sapiens BOP1 protein protein.         36   0.089
AL356133-3|CAH72641.1|  738|Homo sapiens phospholipase A2-activa...    36   0.089
AK223544-1|BAD97264.1|  748|Homo sapiens Hypothetical protein DK...    36   0.089
AK095312-1|BAC04527.1|  895|Homo sapiens protein ( Homo sapiens ...    36   0.089
AK074085-1|BAB84911.1| 1887|Homo sapiens FLJ00156 protein protein.     36   0.089
AK002143-1|BAA92105.1|  544|Homo sapiens protein ( Homo sapiens ...    36   0.089
AJ238243-1|CAB42881.1|  738|Homo sapiens phospholipase A2 activa...    36   0.089
AF385437-1|AAM43838.1|  951|Homo sapiens T-cell activation WD re...    36   0.089
AF145020-1|AAD42075.1|  649|Homo sapiens phospholipase A2 activa...    36   0.089
AF083395-1|AAD03030.1|  738|Homo sapiens phospholipase A2-activa...    36   0.089
AB060694-1|BAB70666.1|  634|Homo sapiens KM-PA-2 protein protein.      36   0.089
AB046827-1|BAB13433.1| 1270|Homo sapiens KIAA1607 protein protein.     36   0.089
AB037795-1|BAA92612.1|  764|Homo sapiens KIAA1374 protein protein.     36   0.089
U57057-1|AAB47807.1|  525|Homo sapiens WD protein IR10 protein.        36   0.12 
BC011690-1|AAH11690.1|  525|Homo sapiens coronin, actin binding ...    36   0.12 
BC000010-1|AAH00010.1|  525|Homo sapiens coronin, actin binding ...    36   0.12 
AL137073-9|CAI13893.1|  525|Homo sapiens coronin, actin binding ...    36   0.12 
AC092618-1|AAX93125.1|   61|Homo sapiens unknown protein.              36   0.12 
BC139834-1|AAI39835.1|  415|Homo sapiens WDR32 protein protein.        36   0.16 
BC113614-1|AAI13615.1| 1508|Homo sapiens gem (nuclear organelle)...    36   0.16 
BC108686-1|AAI08687.1|  412|Homo sapiens WDR32 protein protein.        36   0.16 
BC068499-1|AAH68499.1|  351|Homo sapiens THO complex 3 protein.        36   0.16 
BC066325-1|AAH66325.1|  327|Homo sapiens THOC3 protein protein.        36   0.16 
BC014147-1|AAH14147.2|  921|Homo sapiens GEMIN5 protein protein.       36   0.16 
BC011959-1|AAH11959.2|  320|Homo sapiens WDR32 protein protein.        36   0.16 
BC008858-1|AAH08858.2|  383|Homo sapiens WDR23 protein protein.        36   0.16 
BC008776-1|AAH08776.2|  921|Homo sapiens GEMIN5 protein protein.       36   0.16 
BC006849-1|AAH06849.1|  351|Homo sapiens THO complex 3 protein.        36   0.16 
AY063750-1|AAL38980.1| 1508|Homo sapiens WD repeat protein Gemin...    36   0.16 
AL138752-6|CAI13878.1|  559|Homo sapiens WD repeat domain 32 pro...    36   0.16 
AL031282-15|CAI20051.1|  197|Homo sapiens guanine nucleotide bin...    36   0.16 
AK074066-1|BAB84892.1| 1512|Homo sapiens FLJ00137 protein protein.     36   0.16 
AK022748-1|BAB14222.1|  741|Homo sapiens protein ( Homo sapiens ...    36   0.16 
BC111778-1|AAI11779.1|  395|Homo sapiens WD repeat domain 21C pr...    35   0.21 
BC036894-1|AAH36894.1|  746|Homo sapiens GEMIN5 protein protein.       35   0.21 
BC018698-1|AAH18698.1|  504|Homo sapiens PRP19/PSO4 pre-mRNA pro...    35   0.21 
BC018665-1|AAH18665.1|  504|Homo sapiens PRP19/PSO4 pre-mRNA pro...    35   0.21 
BC008719-1|AAH08719.1|  504|Homo sapiens PRP19/PSO4 pre-mRNA pro...    35   0.21 
AY336091-1|AAR24621.1|  352|Homo sapiens migration-inducing gene...    35   0.21 
AL163279-2|CAB90452.1| 2295|Homo sapiens homolog to cAMP respons...    35   0.21 
AK097600-1|BAC05113.1|  161|Homo sapiens protein ( Homo sapiens ...    35   0.21 
AK093494-1|BAC04184.1|  476|Homo sapiens protein ( Homo sapiens ...    35   0.21 
AK093094-1|BAC04051.1|  395|Homo sapiens protein ( Homo sapiens ...    35   0.21 
AJ292466-1|CAC44372.1| 2269|Homo sapiens WDR9 protein, form B  p...    35   0.21 
AJ292465-1|CAC44371.1| 2320|Homo sapiens WDR9 protein, form A pr...    35   0.21 
AJ243913-1|CAB93145.1|  412|Homo sapiens WD repeat domain 4 prot...    35   0.21 
AJ243912-1|CAB93144.1|  412|Homo sapiens WD repeat domain 4 prot...    35   0.21 
AJ238214-1|CAC37033.2| 2269|Homo sapiens hypothetical protein pr...    35   0.21 

>M24194-1|AAA59626.1|  317|Homo sapiens MHC B complex protein 12.3
           protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>CR541909-1|CAG46707.1|  317|Homo sapiens GNB2L1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>CR456978-1|CAG33259.1|  317|Homo sapiens GNB2L1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC032006-1|AAH32006.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC021993-1|AAH21993.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC019362-1|AAH19362.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC019093-1|AAH19093.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC017287-1|AAH17287.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC014788-1|AAH14788.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC014256-1|AAH14256.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC010119-1|AAH10119.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC000366-1|AAH00366.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>BC000214-1|AAH00214.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDLNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>AY159316-1|AAO21313.1|  347|Homo sapiens lung cancer oncogene 7
           protein.
          Length = 347

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 31  MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 90

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 91  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 136



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 89  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 142

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 143 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 179



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 177 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 231

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 232 PDGSLCASGGKDGQAMLWDLNEGK 255



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 150 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 205

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 206 VWNLANCKLKTNHIGHT 222


>AK222488-1|BAD96208.1|  317|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2-like 1 varia
           protein.
          Length = 317

 Score =  186 bits (454), Expect = 4e-47
 Identities = 81/106 (76%), Positives = 93/106 (87%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M+E + LRGTL+GHNGWVTQIAT P++PDMILS+SRDKT+I+WKLTRDE NYGIPQ+ L 
Sbjct: 1   MTEQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALR 60

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           GHSHF+SDVV+SSDG +ALSGSWD TLRLWDL  G TTRRF  HTK
Sbjct: 61  GHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTK 106



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH+ +V+ +  +       LS S D TL +W LT      G   +R  GH+  +  V 
Sbjct: 59  LRGHSHFVSDVVISSD-GQFALSGSWDGTLRLWDLTT-----GTTTRRFVGHTKDVLSVA 112

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
            SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 113 FSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 149



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 147 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 201

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWD   GK
Sbjct: 202 PDGSLCASGGKDGQAMLWDFNEGK 225



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 120 IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 175

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 176 VWNLANCKLKTNHIGHT 192


>CR457279-1|CAG33560.1|  330|Homo sapiens WDR5B protein.
          Length = 330

 Score = 66.9 bits (156), Expect = 5e-11
 Identities = 38/99 (38%), Positives = 58/99 (58%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH   V+ +  +P   + + SSS D+ +I+W     +  Y   +K LYGH+  I
Sbjct: 33  LKCTLVGHTEAVSSVKFSPN-GEWLASSSADRLIIIWGAY--DGKY---EKTLYGHNLEI 86

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SDV  SSD +  +S S DKTL+LWD+ +GK  +  + H+
Sbjct: 87  SDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHS 125



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 30/100 (30%), Positives = 53/100 (53%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   TL GHN  ++ +A +      ++S+S DKTL +W +       G   K L GHS++
Sbjct: 74  KYEKTLYGHNLEISDVAWSSD-SSRLVSASDDKTLKLWDVRS-----GKCLKTLKGHSNY 127

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+T+++W++  GK  +    H+
Sbjct: 128 VFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHS 167



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 31/94 (32%), Positives = 51/94 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+ +V     NP   ++I+S S D+T+ +W++       G   K L  HS  +S V
Sbjct: 120 TLKGHSNYVFCCNFNPP-SNLIISGSFDETVKIWEVKT-----GKCLKTLSAHSDPVSAV 173

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             +  G+  +SGS+D   R+WD A+G+  +   D
Sbjct: 174 HFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVD 207



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S V  S +G Y L+ + D TL+LWD + G+  + +  H
Sbjct: 213 VSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGH 251



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  +R     G   K   GH +    +  +   + G 
Sbjct: 217 KFSPNGKY---ILTATLDNTLKLWDYSR-----GRCLKTYTGHKNEKYCIFANFSVTGGK 268

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           + +SGS D  + +W+L   +  ++ + HT V
Sbjct: 269 WIVSGSEDNLVYIWNLQTKEIVQKLQGHTDV 299


>BC043494-1|AAH43494.1|  330|Homo sapiens WD repeat domain 5B
           protein.
          Length = 330

 Score = 66.9 bits (156), Expect = 5e-11
 Identities = 38/99 (38%), Positives = 58/99 (58%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH   V+ +  +P   + + SSS D+ +I+W     +  Y   +K LYGH+  I
Sbjct: 33  LKCTLVGHTEAVSSVKFSPN-GEWLASSSADRLIIIWGAY--DGKY---EKTLYGHNLEI 86

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SDV  SSD +  +S S DKTL+LWD+ +GK  +  + H+
Sbjct: 87  SDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHS 125



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 30/100 (30%), Positives = 53/100 (53%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   TL GHN  ++ +A +      ++S+S DKTL +W +       G   K L GHS++
Sbjct: 74  KYEKTLYGHNLEISDVAWSSD-SSRLVSASDDKTLKLWDVRS-----GKCLKTLKGHSNY 127

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+T+++W++  GK  +    H+
Sbjct: 128 VFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHS 167



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 31/94 (32%), Positives = 51/94 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+ +V     NP   ++I+S S D+T+ +W++       G   K L  HS  +S V
Sbjct: 120 TLKGHSNYVFCCNFNPP-SNLIISGSFDETVKIWEVKT-----GKCLKTLSAHSDPVSAV 173

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             +  G+  +SGS+D   R+WD A+G+  +   D
Sbjct: 174 HFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVD 207



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S V  S +G Y L+ + D TL+LWD + G+  + +  H
Sbjct: 213 VSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGH 251



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  +R     G   K   GH +    +  +   + G 
Sbjct: 217 KFSPNGKY---ILTATLDNTLKLWDYSR-----GRCLKTYTGHKNEKYCIFANFSVTGGK 268

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           + +SGS D  + +W+L   +  ++ + HT V
Sbjct: 269 WIVSGSEDNLVYIWNLQTKEIVQKLQGHTDV 299


>AK002149-1|BAA92110.1|  330|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11287 fis, clone PLACE1009596, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1. ).
          Length = 330

 Score = 66.9 bits (156), Expect = 5e-11
 Identities = 38/99 (38%), Positives = 58/99 (58%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L+ TL GH   V+ +  +P   + + SSS D+ +I+W     +  Y   +K LYGH+  I
Sbjct: 33  LKCTLVGHTEAVSSVKFSPN-GEWLASSSADRLIIIWGAY--DGKY---EKTLYGHNLEI 86

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           SDV  SSD +  +S S DKTL+LWD+ +GK  +  + H+
Sbjct: 87  SDVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHS 125



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 30/100 (30%), Positives = 53/100 (53%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   TL GHN  ++ +A +      ++S+S DKTL +W +       G   K L GHS++
Sbjct: 74  KYEKTLYGHNLEISDVAWSSD-SSRLVSASDDKTLKLWDVRS-----GKCLKTLKGHSNY 127

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+T+++W++  GK  +    H+
Sbjct: 128 VFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHS 167



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 31/94 (32%), Positives = 51/94 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+GH+ +V     NP   ++I+S S D+T+ +W++       G   K L  HS  +S V
Sbjct: 120 TLKGHSNYVFCCNFNPP-SNLIISGSFDETVKIWEVKT-----GKCLKTLSAHSDPVSAV 173

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
             +  G+  +SGS+D   R+WD A+G+  +   D
Sbjct: 174 HFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVD 207



 Score = 33.5 bits (73), Expect = 0.63
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +2

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           +S V  S +G Y L+ + D TL+LWD + G+  + +
Sbjct: 213 VSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTY 248



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 22/88 (25%), Positives = 43/88 (48%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL 277
           + + N KY   IL+++ D TL +W  +R         ++   +  F +  V  + G + +
Sbjct: 217 KFSPNGKY---ILTATLDNTLKLWDYSRGRCLKTYTGQKNEKYCIFANFSV--TGGKWIV 271

Query: 278 SGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           SGS D  + +W+L   +  ++ + HT V
Sbjct: 272 SGSEDNLVYIWNLQTKEIVQKLQGHTDV 299


>BX649632-1|CAI18774.1|  334|Homo sapiens WD repeat domain 5
           protein.
          Length = 334

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 39/117 (33%), Positives = 62/117 (52%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           S  ++  KP + +     L+ TL GH   V+ +  +P   + + SSS DK + +W     
Sbjct: 20  SSSATQSKP-TPVKPNYALKFTLAGHTKAVSSVKFSPN-GEWLASSSADKLIKIWGAYD- 76

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               G  +K + GH   ISDV  SSD N  +S S DKTL++WD+++GK  +  + H+
Sbjct: 77  ----GKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS 129



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 29/100 (29%), Positives = 55/100 (55%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +    ++++S+S DKTL +W ++      G   K L GHS++
Sbjct: 78  KFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSS-----GKCLKTLKGHSNY 131

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 132 VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHS 171



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L   
Sbjct: 159 KTGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDD 212

Query: 227 SHF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 213 DNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 255



 Score = 30.3 bits (65), Expect = 5.8
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  ++     G   K   GH +    +  +   + G 
Sbjct: 221 KFSPNGKY---ILAATLDNTLKLWDYSK-----GKCLKTYTGHKNEKYCIFANFSVTGGK 272

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           + +SGS D  + +W+L   +  ++ + HT V
Sbjct: 273 WIVSGSEDNLVYIWNLQTKEIVQKLQGHTDV 303


>BC001635-1|AAH01635.1|  334|Homo sapiens WD repeat domain 5
           protein.
          Length = 334

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 39/117 (33%), Positives = 62/117 (52%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           S  ++  KP + +     L+ TL GH   V+ +  +P   + + SSS DK + +W     
Sbjct: 20  SSSATQSKP-TPVKPNYALKFTLAGHTKAVSSVKFSPN-GEWLASSSADKLIKIWGAYD- 76

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               G  +K + GH   ISDV  SSD N  +S S DKTL++WD+++GK  +  + H+
Sbjct: 77  ----GKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS 129



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 29/100 (29%), Positives = 55/100 (55%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +    ++++S+S DKTL +W ++      G   K L GHS++
Sbjct: 78  KFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSS-----GKCLKTLKGHSNY 131

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 132 VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHS 171



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L   
Sbjct: 159 KTGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDD 212

Query: 227 SHF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 213 DNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 255



 Score = 30.3 bits (65), Expect = 5.8
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  ++     G   K   GH +    +  +   + G 
Sbjct: 221 KFSPNGKY---ILAATLDNTLKLWDYSK-----GKCLKTYTGHKNEKYCIFANFSVTGGK 272

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           + +SGS D  + +W+L   +  ++ + HT V
Sbjct: 273 WIVSGSEDNLVYIWNLQTKEIVQKLQGHTDV 303


>AK000552-1|BAA91248.1|  334|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20545 fis, clone KAT11476. ).
          Length = 334

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 39/117 (33%), Positives = 62/117 (52%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           S  ++  KP + +     L+ TL GH   V+ +  +P   + + SSS DK + +W     
Sbjct: 20  SSSATQSKP-TPVKPNYALKFTLAGHTKAVSSVKFSPN-GEWLASSSADKLIKIWGAYD- 76

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               G  +K + GH   ISDV  SSD N  +S S DKTL++WD+++GK  +  + H+
Sbjct: 77  ----GKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS 129



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 29/100 (29%), Positives = 55/100 (55%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +    ++++S+S DKTL +W ++      G   K L GHS++
Sbjct: 78  KFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSS-----GKCLKTLKGHSNY 131

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 132 VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHS 171



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L   
Sbjct: 159 KTGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDD 212

Query: 227 SHF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 213 DNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 255



 Score = 30.3 bits (65), Expect = 5.8
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  ++     G   K   GH +    +  +   + G 
Sbjct: 221 KFSPNGKY---ILAATLDNTLKLWDYSK-----GKCLKTYTGHKNEKYCIFANFSVTGGK 272

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           + +SGS D  + +W+L   +  ++ + HT V
Sbjct: 273 WIVSGSEDNLVYIWNLQTKEIVQKLQGHTDV 303


>AJ011376-1|CAB66159.1|  362|Homo sapiens hypothetical protein
           protein.
          Length = 362

 Score = 62.9 bits (146), Expect = 9e-10
 Identities = 39/117 (33%), Positives = 62/117 (52%)
 Frame = +2

Query: 5   SGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           S  ++  KP + +     L+ TL GH   V+ +  +P   + + SSS DK + +W     
Sbjct: 48  SSSATQSKP-TPVKPNYALKFTLAGHTKAVSSVKFSPN-GEWLASSSADKLIKIWGAYD- 104

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               G  +K + GH   ISDV  SSD N  +S S DKTL++WD+++GK  +  + H+
Sbjct: 105 ----GKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS 157



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 29/100 (29%), Positives = 55/100 (55%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +    ++++S+S DKTL +W ++      G   K L GHS++
Sbjct: 106 KFEKTISGHKLGISDVAWSSD-SNLLVSASDDKTLKIWDVSS-----GKCLKTLKGHSNY 159

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 160 VFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHS 199



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L   
Sbjct: 187 KTGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDD 240

Query: 227 SHF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 241 DNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 283



 Score = 30.3 bits (65), Expect = 5.8
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  ++     G   K   GH +    +  +   + G 
Sbjct: 249 KFSPNGKY---ILAATLDNTLKLWDYSK-----GKCLKTYTGHKNEKYCIFANFSVTGGK 300

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           + +SGS D  + +W+L   +  ++ + HT V
Sbjct: 301 WIVSGSEDNLVYIWNLQTKEIVQKLQGHTDV 331


>CR456762-1|CAG33043.1|  655|Homo sapiens KATNB1 protein.
          Length = 655

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 33/103 (32%), Positives = 50/103 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH   +  +  +P Y + + S S+D  + +W + R    +     R  GH
Sbjct: 93  EAAKILRTLMGHKANICSLDFHP-YGEFVASGSQDTNIKLWDIRRKGCVF-----RYRGH 146

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  +  +  S DG +  S + D T++LWDL AGK    F  HT
Sbjct: 147 SQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHT 189



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 24/97 (24%), Positives = 43/97 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +  N    ++I++ S+  ++ VW L   +       + L GH   I  +
Sbjct: 58  SLTGHTSPVESVRLNTP-EELIVAGSQSGSIRVWDLEAAKI-----LRTLMGHKANICSL 111

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G +  SGS D  ++LWD+       R+  H++
Sbjct: 112 DFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQ 148



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH+  V  +  +P     + S++ D T+ +W LT  +     P     GH+  ++ V  
Sbjct: 144 RGHSQAVRCLRFSPD-GKWLASAADDHTVKLWDLTAGKMMSEFP-----GHTGPVNVVEF 197

Query: 254 SSDGNYALSGSWDKTLRLWDL 316
             +     SGS D+T+R WDL
Sbjct: 198 HPNEYLLASGSSDRTIRFWDL 218


>BT007022-1|AAP35668.1|  655|Homo sapiens katanin p80
           (WD40-containing) subunit B 1 protein.
          Length = 655

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 33/103 (32%), Positives = 50/103 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH   +  +  +P Y + + S S+D  + +W + R    +     R  GH
Sbjct: 93  EAAKILRTLMGHKANICSLDFHP-YGEFVASGSQDTNIKLWDIRRKGCVF-----RYRGH 146

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  +  +  S DG +  S + D T++LWDL AGK    F  HT
Sbjct: 147 SQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHT 189



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 24/97 (24%), Positives = 43/97 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +  N    ++I++ S+  ++ VW L   +       + L GH   I  +
Sbjct: 58  SLTGHTSPVESVRLNTP-EELIVAGSQSGSIRVWDLEAAKI-----LRTLMGHKANICSL 111

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G +  SGS D  ++LWD+       R+  H++
Sbjct: 112 DFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQ 148



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH+  V  +  +P     + S++ D T+ +W LT  +     P     GH+  ++ V  
Sbjct: 144 RGHSQAVRCLRFSPD-GKWLASAADDHTVKLWDLTAGKMMSEFP-----GHTGPVNVVEF 197

Query: 254 SSDGNYALSGSWDKTLRLWDL 316
             +     SGS D+T+R WDL
Sbjct: 198 HPNEYLLASGSSDRTIRFWDL 218


>BC001353-1|AAH01353.1|  655|Homo sapiens katanin p80 (WD repeat
           containing) subunit B 1 protein.
          Length = 655

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 33/103 (32%), Positives = 50/103 (48%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL GH   +  +  +P Y + + S S+D  + +W + R    +     R  GH
Sbjct: 93  EAAKILRTLMGHKANICSLDFHP-YGEFVASGSQDTNIKLWDIRRKGCVF-----RYRGH 146

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  +  +  S DG +  S + D T++LWDL AGK    F  HT
Sbjct: 147 SQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHT 189



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 24/97 (24%), Positives = 43/97 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +  N    ++I++ S+  ++ VW L   +       + L GH   I  +
Sbjct: 58  SLTGHTSPVESVRLNTP-EELIVAGSQSGSIRVWDLEAAKI-----LRTLMGHKANICSL 111

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G +  SGS D  ++LWD+       R+  H++
Sbjct: 112 DFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQ 148



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 24/81 (29%), Positives = 39/81 (48%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH+  V  +  +P     + S++ D T+ +W LT  +     P     GH+  ++ V  
Sbjct: 144 RGHSQAVRCLRFSPD-GKWLASAADDHTVKLWDLTAGKMMSEFP-----GHTGPVNVVEF 197

Query: 254 SSDGNYALSGSWDKTLRLWDL 316
             +     SGS D+T+R WDL
Sbjct: 198 HPNEYLLASGSSDRTIRFWDL 218


>BC012352-1|AAH12352.1|  366|Homo sapiens WDR31 protein protein.
          Length = 366

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/89 (31%), Positives = 50/89 (56%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +T++A  PK      S+SRD+ +++W L         P+++L GH+  ++ + +
Sbjct: 99  KGHEHEITKVACIPK-SSQFFSASRDRMVMMWDLHGSSQ----PRQQLCGHAMVVTGLAV 153

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
           S D +   +GS D TL LWD+  G++  R
Sbjct: 154 SPDSSQLCTGSRDNTLLLWDVVTGQSVER 182



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 26/84 (30%), Positives = 40/84 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R  L GH   VT +A +P     + + SRD TL++W +   ++      +R     + ++
Sbjct: 138 RQQLCGHAMVVTGLAVSPD-SSQLCTGSRDNTLLLWDVVTGQS-----VERASVSRNVVT 191

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y L  S DKTLRLWD
Sbjct: 192 HLCWVPREPYILQTSEDKTLRLWD 215



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D+ +S  +DKT++ +         G   KR  GH H I+ V      +   S S D+ + 
Sbjct: 73  DLCVSGGKDKTVVAYNWKT-----GNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVM 127

Query: 305 LWDLAAGKTTRR 340
           +WDL      R+
Sbjct: 128 MWDLHGSSQPRQ 139


>AL449305-1|CAI10961.1|  367|Homo sapiens WD repeat domain 31
           protein.
          Length = 367

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/89 (31%), Positives = 50/89 (56%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +T++A  PK      S+SRD+ +++W L         P+++L GH+  ++ + +
Sbjct: 100 KGHEHEITKVACIPK-SSQFFSASRDRMVMMWDLHGSSQ----PRQQLCGHAMVVTGLAV 154

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
           S D +   +GS D TL LWD+  G++  R
Sbjct: 155 SPDSSQLCTGSRDNTLLLWDVVTGQSVER 183



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 26/84 (30%), Positives = 40/84 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R  L GH   VT +A +P     + + SRD TL++W +   ++      +R     + ++
Sbjct: 139 RQQLCGHAMVVTGLAVSPD-SSQLCTGSRDNTLLLWDVVTGQS-----VERASVSRNVVT 192

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y L  S DKTLRLWD
Sbjct: 193 HLCWVPREPYILQTSEDKTLRLWD 216



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D+ +S  +DKT++ +         G   KR  GH H I+ V      +   S S D+ + 
Sbjct: 74  DLCVSGGKDKTVVAYNWKT-----GNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVM 128

Query: 305 LWDLAAGKTTRR 340
           +WDL      R+
Sbjct: 129 MWDLHGSSQPRQ 140


>AL137066-1|CAH70096.1|  367|Homo sapiens WD repeat domain 31
           protein.
          Length = 367

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/89 (31%), Positives = 50/89 (56%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +T++A  PK      S+SRD+ +++W L         P+++L GH+  ++ + +
Sbjct: 100 KGHEHEITKVACIPK-SSQFFSASRDRMVMMWDLHGSSQ----PRQQLCGHAMVVTGLAV 154

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
           S D +   +GS D TL LWD+  G++  R
Sbjct: 155 SPDSSQLCTGSRDNTLLLWDVVTGQSVER 183



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 26/84 (30%), Positives = 40/84 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R  L GH   VT +A +P     + + SRD TL++W +   ++      +R     + ++
Sbjct: 139 RQQLCGHAMVVTGLAVSPD-SSQLCTGSRDNTLLLWDVVTGQS-----VERASVSRNVVT 192

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y L  S DKTLRLWD
Sbjct: 193 HLCWVPREPYILQTSEDKTLRLWD 216



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D+ +S  +DKT++ +         G   KR  GH H I+ V      +   S S D+ + 
Sbjct: 74  DLCVSGGKDKTVVAYNWKT-----GNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVM 128

Query: 305 LWDLAAGKTTRR 340
           +WDL      R+
Sbjct: 129 MWDLHGSSQPRQ 140


>AK093240-1|BAC04106.1|  367|Homo sapiens protein ( Homo sapiens
           cDNA FLJ35921 fis, clone TESTI2010617, highly similar to
           Mus musculus spermatid WD-repeat protein mRNA. ).
          Length = 367

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 28/89 (31%), Positives = 50/89 (56%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +T++A  PK      S+SRD+ +++W L         P+++L GH+  ++ + +
Sbjct: 100 KGHEHEITKVACIPK-SSQFFSASRDRMVMMWDLHGSSQ----PRQQLCGHAMVVTGLAV 154

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
           S D +   +GS D TL LWD+  G++  R
Sbjct: 155 SPDSSQLCTGSRDNTLLLWDVVTGQSVER 183



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 26/84 (30%), Positives = 40/84 (47%)
 Frame = +2

Query: 62  RGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           R  L GH   VT +A +P     + + SRD TL++W +   ++      +R     + ++
Sbjct: 139 RQQLCGHAMVVTGLAVSPD-SSQLCTGSRDNTLLLWDVVTGQS-----VERASVSRNVVT 192

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y L  S DKTLRLWD
Sbjct: 193 HLCWVPREPYILQTSEDKTLRLWD 216



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D+ +S  +DKT++ +         G   KR  GH H I+ V      +   S S D+ + 
Sbjct: 74  DLCVSGGKDKTVVAYNWKT-----GNVVKRFKGHEHEITKVACIPKSSQFFSASRDRMVM 128

Query: 305 LWDLAAGKTTRR 340
           +WDL      R+
Sbjct: 129 MWDLHGSSQPRQ 140


>AK127882-1|BAC87175.1|  369|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45988 fis, clone PUAEN2006639, weakly  similar
           to Vegetatible incompatibility protein HET-E-1. ).
          Length = 369

 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 43/130 (33%), Positives = 60/130 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH+  +  ++ N    D I++ S D T++VW     + + G     L GH   IS  
Sbjct: 214 TLRGHSAEIISLSFNTS-GDRIITGSFDHTVVVW-----DADTGRKVNILIGHCAEISSA 267

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNADYALKIILSA 427
             + D +  L+GS DKT +LWD   GK       H     +S F      DY  K+I +A
Sbjct: 268 SFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCF------DYTGKLIATA 321

Query: 428 YARQKTSVLC 457
            A    S LC
Sbjct: 322 SADDGVS-LC 330



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 47/94 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K   T RGH   +  ++ NP+   ++ + S D T  +W +   E  Y      L GH
Sbjct: 165 ETGKCYHTFRGHTAEIVCLSFNPQ-STLVATGSMDTTAKLWDIQNGEEVY-----TLRGH 218

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           S  I  +  ++ G+  ++GS+D T+ +WD   G+
Sbjct: 219 SAEIISLSFNTSGDRIITGSFDHTVVVWDADTGR 252



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/96 (30%), Positives = 40/96 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  IA N  Y D I + S DKT  +W +       G       GH+  I  +
Sbjct: 129 TLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVET-----GKCYHTFRGHTAEIVCL 183

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +       +GS D T +LWD+  G+       H+
Sbjct: 184 SFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHS 219



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 1/105 (0%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           + T  L   L+ H   +T +A N K     ++ S D+T  +W     ++  G     L G
Sbjct: 79  NHTFYLFKVLKAHILPLTNVALN-KSGSCFITGSYDRTCKLW-----DSASGEELNTLEG 132

Query: 224 HSHFISDVVLSSD-GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H + +  +  ++  G+   +GS+DKT +LW +  GK    F  HT
Sbjct: 133 HRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHT 177



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           KL ++ N+     K L  H   +++V L+  G+  ++GS+D+T +LWD A+G+     E 
Sbjct: 73  KLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDSASGEELNTLEG 132

Query: 350 HTKV 361
           H  V
Sbjct: 133 HRNV 136


>EF011621-1|ABK41111.1|  357|Homo sapiens CDW11/WDR57 protein.
          Length = 357

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 29/95 (30%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P     + S+  D+ +++W +  D +NY      L GHS  + ++ 
Sbjct: 62  LSGHEGEVYCCKFHPN-GSTLASAGFDRLILLWNVYGDCDNYAT----LKGHSGAVMELH 116

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++DG+   S S DKT+ +WD   G+  +R + HT
Sbjct: 117 YNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHT 151



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S   D  + VW L +++  Y      + GH+  ++ + LSS+G+Y LS + D T+R
Sbjct: 206 DQIISGGIDNDIKVWDLRQNKLTY-----TMRGHADSVTGLSLSSEGSYLLSNAMDNTVR 260

Query: 305 LWDL 316
           +WD+
Sbjct: 261 VWDV 264



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 22/103 (21%), Positives = 45/103 (43%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           SET +    L+GH  +V       + P ++ + S D T+ +W + +          + + 
Sbjct: 138 SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKA------AIQTFQ 191

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++ +  V  +   +  +SG  D  +++WDL   K T     H
Sbjct: 192 NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGH 234



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 3/102 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL---TRDENNYGIPQKRLYGH 226
           KL  T+RGH   VT ++ + +    +LS++ D T+ VW +      E    I Q  ++  
Sbjct: 226 KLTYTMRGHADSVTGLSLSSE-GSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNF 284

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +     S DG+   +GS D+ + +WD  + +   +   H
Sbjct: 285 EKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGH 326


>BC001494-1|AAH01494.1|  357|Homo sapiens WD repeat domain 57 (U5
           snRNP specific) protein.
          Length = 357

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 29/95 (30%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P     + S+  D+ +++W +  D +NY      L GHS  + ++ 
Sbjct: 62  LSGHEGEVYCCKFHPN-GSTLASAGFDRLILLWNVYGDCDNYAT----LKGHSGAVMELH 116

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++DG+   S S DKT+ +WD   G+  +R + HT
Sbjct: 117 YNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHT 151



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S   D  + VW L +++  Y      + GH+  ++ + LSS+G+Y LS + D T+R
Sbjct: 206 DQIISGGIDNDIKVWDLRQNKLTY-----TMRGHADSVTGLSLSSEGSYLLSNAMDNTVR 260

Query: 305 LWDL 316
           +WD+
Sbjct: 261 VWDV 264



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 22/103 (21%), Positives = 45/103 (43%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           SET +    L+GH  +V       + P ++ + S D T+ +W + +          + + 
Sbjct: 138 SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKA------AIQTFQ 191

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++ +  V  +   +  +SG  D  +++WDL   K T     H
Sbjct: 192 NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGH 234



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 3/102 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL---TRDENNYGIPQKRLYGH 226
           KL  T+RGH   VT ++ + +    +LS++ D T+ VW +      E    I Q  ++  
Sbjct: 226 KLTYTMRGHADSVTGLSLSSE-GSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNF 284

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +     S DG+   +GS D+ + +WD  + +   +   H
Sbjct: 285 EKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGH 326


>AL451070-1|CAH71848.1|  357|Homo sapiens WD repeat domain 57 (U5
           snRNP specific) protein.
          Length = 357

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 29/95 (30%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P     + S+  D+ +++W +  D +NY      L GHS  + ++ 
Sbjct: 62  LSGHEGEVYCCKFHPN-GSTLASAGFDRLILLWNVYGDCDNYAT----LKGHSGAVMELH 116

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++DG+   S S DKT+ +WD   G+  +R + HT
Sbjct: 117 YNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHT 151



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S   D  + VW L +++  Y      + GH+  ++ + LSS+G+Y LS + D T+R
Sbjct: 206 DQIISGGIDNDIKVWDLRQNKLTY-----TMRGHADSVTGLSLSSEGSYLLSNAMDNTVR 260

Query: 305 LWDL 316
           +WD+
Sbjct: 261 VWDV 264



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 22/103 (21%), Positives = 45/103 (43%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           SET +    L+GH  +V       + P ++ + S D T+ +W + +          + + 
Sbjct: 138 SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKA------AIQTFQ 191

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++ +  V  +   +  +SG  D  +++WDL   K T     H
Sbjct: 192 NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGH 234



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 3/102 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL---TRDENNYGIPQKRLYGH 226
           KL  T+RGH   VT ++ + +    +LS++ D T+ VW +      E    I Q  ++  
Sbjct: 226 KLTYTMRGHADSVTGLSLSSE-GSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNF 284

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +     S DG+   +GS D+ + +WD  + +   +   H
Sbjct: 285 EKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGH 326


>AF090988-1|AAC69625.1|  357|Homo sapiens U5 snRNP-specific 40 kDa
           protein protein.
          Length = 357

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 29/95 (30%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P     + S+  D+ +++W +  D +NY      L GHS  + ++ 
Sbjct: 62  LSGHEGEVYCCKFHPN-GSTLASAGFDRLILLWNVYGDCDNYAT----LKGHSGAVMELH 116

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++DG+   S S DKT+ +WD   G+  +R + HT
Sbjct: 117 YNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHT 151



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S   D  + VW L +++  Y      + GH+  ++ + LSS+G+Y LS + D T+R
Sbjct: 206 DQIISGGIDNDIKVWDLRQNKLTY-----TMRGHADSVTGLSLSSEGSYLLSNAMDNTVR 260

Query: 305 LWDL 316
           +WD+
Sbjct: 261 VWDV 264



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 23/103 (22%), Positives = 45/103 (43%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           SET +    L+GH  +V       K P ++ + S D T+ +W + +          + + 
Sbjct: 138 SETGERVKRLKGHTSFVNSCYPARKSPQLVCTGSDDGTVKLWDIRKK------AAIQTFQ 191

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++ +  V  +   +  +SG  D  +++WDL   K T     H
Sbjct: 192 NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGH 234



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 3/102 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL---TRDENNYGIPQKRLYGH 226
           KL  T+RGH   VT ++ + +    +LS++ D T+ VW +      E    I Q  ++  
Sbjct: 226 KLTYTMRGHADSVTGLSLSSE-GSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNF 284

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              +     S DG+   +GS D+ + +WD  + +   +   H
Sbjct: 285 EKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGH 326


>AF083383-1|AAC64084.1|  310|Homo sapiens 38kDa splicing factor
           protein.
          Length = 310

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 29/95 (30%), Positives = 49/95 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P     + S+  D+ +++W +  D +NY      L GHS  + ++ 
Sbjct: 3   LSGHEGEVYCCKFHPN-GSTLASAGFDRLILLWNVYGDCDNYAT----LKGHSGAVMELH 57

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            ++DG+   S S DKT+ +WD   G+  +R + HT
Sbjct: 58  YNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHT 92



 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 22/64 (34%), Positives = 38/64 (59%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I+S   D  + VW L +++  Y      + GH+  ++ + LSS+G+Y LS + D T+R
Sbjct: 147 DQIISGGIDNDIKVWDLRQNKLTY-----TMRGHADSVTGLSLSSEGSYLLSNAMDNTVR 201

Query: 305 LWDL 316
           +WD+
Sbjct: 202 VWDV 205



 Score = 37.5 bits (83), Expect = 0.038
 Identities = 22/103 (21%), Positives = 45/103 (43%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           SET +    L+GH  +V       + P ++ + S D T+ +W + +          + + 
Sbjct: 79  SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKA------AVQTFQ 132

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++ +  V  +   +  +SG  D  +++WDL   K T     H
Sbjct: 133 NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGH 175



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL---TRDENNYGIPQKRLYGH 226
           KL  T+RGH   VT ++ + +    +LS++ D T+ VW +      E    I Q  ++  
Sbjct: 167 KLTYTMRGHADSVTGLSLSSE-GSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNF 225

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
              +     S DG+   +GS D+ + +WD  + ++
Sbjct: 226 EKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRS 260


>AF052432-1|AAC09328.1|  655|Homo sapiens katanin p80 subunit
           protein.
          Length = 655

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 32/103 (31%), Positives = 49/103 (47%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           E  K+  TL G    +  +  +P Y + + S S+D  + +W + R    +     R  GH
Sbjct: 93  EAAKILRTLMGLKANICSLDFHP-YGEFVASGSQDTNIKLWDIRRKGCVF-----RYRGH 146

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  +  +  S DG +  S + D T++LWDL AGK    F  HT
Sbjct: 147 SQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHT 189



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 26/91 (28%), Positives = 41/91 (45%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           RGH+  V  +  +P     + S++ D T+ +W LT  +     P     GH+  ++ V  
Sbjct: 144 RGHSQAVRCLRFSPD-GKWLASAADDHTVKLWDLTAGKMMSEFP-----GHTGPVNVVEF 197

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
             +     SGS D T+R WDL   +   R E
Sbjct: 198 HPNEYLLASGSSDGTIRFWDLEKFQVVSRIE 228



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 23/97 (23%), Positives = 42/97 (43%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +  N    ++I++ S+  ++ VW L   +       + L G    I  +
Sbjct: 58  SLTGHTSPVESVRLNTP-EELIVAGSQSGSIRVWDLEAAKI-----LRTLMGLKANICSL 111

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                G +  SGS D  ++LWD+       R+  H++
Sbjct: 112 DFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQ 148


>BC036377-1|AAH36377.1|  415|Homo sapiens WD repeat domain 69
           protein.
          Length = 415

 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 40/122 (32%), Positives = 57/122 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH+  +  ++ N    D I++ S D T++VW     + + G     L GH   IS  
Sbjct: 214 TLRGHSAEIISLSFNTS-GDRIITGSFDHTVVVW-----DADTGRKVNILIGHCAEISSA 267

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNADYALKIILSA 427
             + D +  L+GS DKT +LWD   GK       H     +S F      DY  K+I +A
Sbjct: 268 SFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCF------DYTGKLIATA 321

Query: 428 YA 433
            A
Sbjct: 322 SA 323



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 47/94 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K   T RGH   +  ++ NP+   ++ + S D T  +W +   E  Y      L GH
Sbjct: 165 ETGKCYHTFRGHTAEIVCLSFNPQ-STLVATGSMDTTAKLWDIQNGEEVY-----TLRGH 218

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           S  I  +  ++ G+  ++GS+D T+ +WD   G+
Sbjct: 219 SAEIISLSFNTSGDRIITGSFDHTVVVWDADTGR 252



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 28/87 (32%), Positives = 44/87 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K    L GH G +++I+ NP+  + +L+ S DKT  +W     +   G   + L GH+
Sbjct: 334 TRKCIAKLEGHEGEISKISFNPQ-GNHLLTGSSDKTARIW-----DAQTGQCLQVLEGHT 387

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             I     +  GN  ++GS D T R+W
Sbjct: 388 DEIFSCAFNYKGNIVITGSKDNTCRIW 414



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L GH   IS +  +  GN+ L+GS DKT R+WD   G+  +  E HT
Sbjct: 340 KLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHT 387



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/96 (30%), Positives = 40/96 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  IA N  Y D I + S DKT  +W +       G       GH+  I  +
Sbjct: 129 TLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVET-----GKCYHTFRGHTAEIVCL 183

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +       +GS D T +LWD+  G+       H+
Sbjct: 184 SFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHS 219



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           + T  L   L+ H   +T +A N K     ++ S D+T  +W     E         L G
Sbjct: 79  NHTFYLFKVLKAHILPLTNVALN-KSGSCFITGSYDRTCKLWDTASGEE-----LNTLEG 132

Query: 224 HSHFISDVVLSSD-GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H + +  +  ++  G+   +GS+DKT +LW +  GK    F  HT
Sbjct: 133 HRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHT 177



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           KL ++ N+     K L  H   +++V L+  G+  ++GS+D+T +LWD A+G+     E 
Sbjct: 73  KLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEG 132

Query: 350 HTKV 361
           H  V
Sbjct: 133 HRNV 136


>AK098821-1|BAC05425.1|  415|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25955 fis, clone TST03904. ).
          Length = 415

 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 40/122 (32%), Positives = 57/122 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH+  +  ++ N    D I++ S D T++VW     + + G     L GH   IS  
Sbjct: 214 TLRGHSAEIISLSFNTS-GDRIITGSFDHTVVVW-----DADTGRKVNILIGHCAEISSA 267

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNADYALKIILSA 427
             + D +  L+GS DKT +LWD   GK       H     +S F      DY  K+I +A
Sbjct: 268 SFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCF------DYTGKLIATA 321

Query: 428 YA 433
            A
Sbjct: 322 SA 323



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 47/94 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K   T RGH   +  ++ NP+   ++ + S D T  +W +   E  Y      L GH
Sbjct: 165 ETGKCYHTFRGHTAEIVCLSFNPQ-STLVATGSMDTTAKLWDIQNGEEVY-----TLRGH 218

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           S  I  +  ++ G+  ++GS+D T+ +WD   G+
Sbjct: 219 SAEIISLSFNTSGDRIITGSFDHTVVVWDADTGR 252



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L GH   IS +  +  GN+ L+GS DKT R+WD   G+  +  E HT
Sbjct: 340 KLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHT 387



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/96 (30%), Positives = 40/96 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  IA N  Y D I + S DKT  +W +       G       GH+  I  +
Sbjct: 129 TLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVET-----GKCYHTFRGHTAEIVCL 183

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +       +GS D T +LWD+  G+       H+
Sbjct: 184 SFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHS 219



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 1/105 (0%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           + T  L   L+ H   +T +A N K     ++ S D+T  +W     ++  G     L G
Sbjct: 79  NHTFYLFKVLKAHILPLTNVALN-KSGSCFITGSYDRTCKLW-----DSASGEELNTLEG 132

Query: 224 HSHFISDVVLSSD-GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H + +  +  ++  G+   +GS+DKT +LW +  GK    F  HT
Sbjct: 133 HRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHT 177



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 27/87 (31%), Positives = 43/87 (49%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K    L GH G +++I+ NP+  + +L+ S DKT  +W     +   G   + L GH+
Sbjct: 334 TRKCIAKLEGHEGEISKISFNPQ-GNHLLTGSSDKTARIW-----DAQTGQCLQVLEGHT 387

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             I     +  GN  ++GS   T R+W
Sbjct: 388 DEIFSCAFNYKGNIVITGSKGNTCRIW 414



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           KL ++ N+     K L  H   +++V L+  G+  ++GS+D+T +LWD A+G+     E 
Sbjct: 73  KLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDSASGEELNTLEG 132

Query: 350 HTKV 361
           H  V
Sbjct: 133 HRNV 136


>AK097409-1|BAC05039.1|  415|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40090 fis, clone TESTI2003596, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1. ).
          Length = 415

 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 40/122 (32%), Positives = 57/122 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH+  +  ++ N    D I++ S D T++VW     + + G     L GH   IS  
Sbjct: 214 TLRGHSAEIISLSFNTS-GDRIITGSFDHTVVVW-----DADTGRKVNILIGHCAEISSA 267

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNADYALKIILSA 427
             + D +  L+GS DKT +LWD   GK       H     +S F      DY  K+I +A
Sbjct: 268 SFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCF------DYTGKLIATA 321

Query: 428 YA 433
            A
Sbjct: 322 SA 323



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 47/94 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K   T RGH   +  ++ NP+   ++ + S D T  +W +   E  Y      L GH
Sbjct: 165 ETGKCYHTFRGHTAEIVCLSFNPQ-STLVATGSMDTTAKLWDIQNGEEVY-----TLRGH 218

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           S  I  +  ++ G+  ++GS+D T+ +WD   G+
Sbjct: 219 SAEIISLSFNTSGDRIITGSFDHTVVVWDADTGR 252



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 28/87 (32%), Positives = 44/87 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K    L GH G +++I+ NP+  + +L+ S DKT  +W     +   G   + L GH+
Sbjct: 334 TRKCIAKLEGHEGEISKISFNPQ-GNHLLTGSSDKTARIW-----DAQTGQCLQVLEGHT 387

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             I     +  GN  ++GS D T R+W
Sbjct: 388 DEIFSCAFNYKGNIVITGSKDNTCRIW 414



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L GH   IS +  +  GN+ L+GS DKT R+WD   G+  +  E HT
Sbjct: 340 KLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHT 387



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/96 (30%), Positives = 40/96 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  IA N  Y D I + S DKT  +W +       G       GH+  I  +
Sbjct: 129 TLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVET-----GKCYHTFRGHTAEIVCL 183

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +       +GS D T +LWD+  G+       H+
Sbjct: 184 SFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHS 219



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           + T  L   L+ H   +T +A N K     ++ S D+T  +W     E         L G
Sbjct: 79  NHTFYLFKVLKAHILPLTNVALN-KSGSCFITGSYDRTCKLWDTASGEE-----LNTLEG 132

Query: 224 HSHFISDVVLSSD-GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H + +  +  ++  G+   +GS+DKT +LW +  GK    F  HT
Sbjct: 133 HRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHT 177



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           KL ++ N+     K L  H   +++V L+  G+  ++GS+D+T +LWD A+G+     E 
Sbjct: 73  KLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEG 132

Query: 350 HTKV 361
           H  V
Sbjct: 133 HRNV 136


>AC073065-2|AAX93215.1|  415|Homo sapiens unknown protein.
          Length = 415

 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 40/122 (32%), Positives = 57/122 (46%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH+  +  ++ N    D I++ S D T++VW     + + G     L GH   IS  
Sbjct: 214 TLRGHSAEIISLSFNTS-GDRIITGSFDHTVVVW-----DADTGRKVNILIGHCAEISSA 267

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVNADYALKIILSA 427
             + D +  L+GS DKT +LWD   GK       H     +S F      DY  K+I +A
Sbjct: 268 SFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCF------DYTGKLIATA 321

Query: 428 YA 433
            A
Sbjct: 322 SA 323



 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 47/94 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET K   T RGH   +  ++ NP+   ++ + S D T  +W +   E  Y      L GH
Sbjct: 165 ETGKCYHTFRGHTAEIVCLSFNPQ-STLVATGSMDTTAKLWDIQNGEEVY-----TLRGH 218

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           S  I  +  ++ G+  ++GS+D T+ +WD   G+
Sbjct: 219 SAEIISLSFNTSGDRIITGSFDHTVVVWDADTGR 252



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 28/87 (32%), Positives = 44/87 (50%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K    L GH G +++I+ NP+  + +L+ S DKT  +W     +   G   + L GH+
Sbjct: 334 TRKCIAKLEGHEGEISKISFNPQ-GNHLLTGSSDKTARIW-----DAQTGQCLQVLEGHT 387

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             I     +  GN  ++GS D T R+W
Sbjct: 388 DEIFSCAFNYKGNIVITGSKDNTCRIW 414



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +L GH   IS +  +  GN+ L+GS DKT R+WD   G+  +  E HT
Sbjct: 340 KLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHT 387



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/96 (30%), Positives = 40/96 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH   V  IA N  Y D I + S DKT  +W +       G       GH+  I  +
Sbjct: 129 TLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVET-----GKCYHTFRGHTAEIVCL 183

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             +       +GS D T +LWD+  G+       H+
Sbjct: 184 SFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHS 219



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 1/105 (0%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           + T  L   L+ H   +T +A N K     ++ S D+T  +W     E         L G
Sbjct: 79  NHTFYLFKVLKAHILPLTNVALN-KSGSCFITGSYDRTCKLWDTASGEE-----LNTLEG 132

Query: 224 HSHFISDVVLSSD-GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H + +  +  ++  G+   +GS+DKT +LW +  GK    F  HT
Sbjct: 133 HRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHT 177



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +2

Query: 170 KLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
           KL ++ N+     K L  H   +++V L+  G+  ++GS+D+T +LWD A+G+     E 
Sbjct: 73  KLGQNSNHTFYLFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEG 132

Query: 350 HTKV 361
           H  V
Sbjct: 133 HRNV 136


>BC012075-1|AAH12075.1|  485|Homo sapiens notchless homolog 1
           (Drosophila) protein.
          Length = 485

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 38/77 (49%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P+ ++S S D TL +W    D+     P  R+ GH   I+ V+ S D     S S+DK++
Sbjct: 341 PERLVSGSDDFTLFLWSPAEDKK----PLTRMTGHQALINQVLFSPDSRIVASASFDKSI 396

Query: 302 RLWDLAAGKTTRRFEDH 352
           +LWD   GK       H
Sbjct: 397 KLWDGRTGKYLASLRGH 413



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   + Q+  +P    ++ S+S DK++ +W     +   G     L GH   +  + 
Sbjct: 368 MTGHQALINQVLFSPD-SRIVASASFDKSIKLW-----DGRTGKYLASLRGHVAAVYQIA 421

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D    +SGS D TL++WD+ A K       H
Sbjct: 422 WSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGH 455



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   +LRGH   V QIA +     +++S S D TL VW +   +    +P     GH+
Sbjct: 403 TGKYLASLRGHVAAVYQIAWSAD-SRLLVSGSSDSTLKVWDVKAQKLAMDLP-----GHA 456

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S DG    SG  DK LR+W
Sbjct: 457 DEVYAVDWSPDGQRVASGGKDKCLRIW 483



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           TL GH+ W+T ++  P + +     + SSS+D ++ +W  T      G  ++ L GH+  
Sbjct: 194 TLAGHSKWITGLSWEPLHANPECRYVASSSKDGSVRIWDTTA-----GRCERILTGHTQS 248

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ +    DG    S S D+T+++W    G   R  + H
Sbjct: 249 VTCLRWGGDG-LLYSASQDRTIKVWRAHDGVLCRTLQGH 286



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH+  V  +A +P     + S S D T+  W L+ +      P     GH H++  +
Sbjct: 109 SLEGHSEAVISVAFSPT-GKYLASGSGDTTVRFWDLSTET-----PHFTCKGHRHWVLSI 162

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTT-RRFEDHTK 358
             S DG    SG  +  + LWD + GK   R    H+K
Sbjct: 163 SWSPDGKKLASGCKNGQILLWDPSTGKQVGRTLAGHSK 200



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 5/102 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH  WV  I+ +P     + S  ++  +++W    D +      + L GHS +I+ +
Sbjct: 151 TCKGHRHWVLSISWSPD-GKKLASGCKNGQILLW----DPSTGKQVGRTLAGHSKWITGL 205

Query: 248 V-----LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                  + +  Y  S S D ++R+WD  AG+  R    HT+
Sbjct: 206 SWEPLHANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQ 247



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 32/50 (64%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL 277
           ++ S+S+D+T+ VW+      + G+  + L GH H+++ + LS+D  YAL
Sbjct: 259 LLYSASQDRTIKVWRA-----HDGVLCRTLQGHGHWVNTMALSTD--YAL 301


>BC002884-1|AAH02884.2|  484|Homo sapiens NLE1 protein protein.
          Length = 484

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 38/77 (49%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P+ ++S S D TL +W    D+     P  R+ GH   I+ V+ S D     S S+DK++
Sbjct: 340 PERLVSGSDDFTLFLWSPAEDKK----PLTRMTGHQALINQVLFSPDSRIVASASFDKSI 395

Query: 302 RLWDLAAGKTTRRFEDH 352
           +LWD   GK       H
Sbjct: 396 KLWDGRTGKYLASLRGH 412



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   + Q+  +P    ++ S+S DK++ +W     +   G     L GH   +  + 
Sbjct: 367 MTGHQALINQVLFSPD-SRIVASASFDKSIKLW-----DGRTGKYLASLRGHVAAVYQIA 420

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D    +SGS D TL++WD+ A K       H
Sbjct: 421 WSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGH 454



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   +LRGH   V QIA +     +++S S D TL VW +   +    +P     GH+
Sbjct: 402 TGKYLASLRGHVAAVYQIAWSAD-SRLLVSGSSDSTLKVWDVKAQKLAMDLP-----GHA 455

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S DG    SG  DK LR+W
Sbjct: 456 DEVYAVDWSPDGQRVASGGKDKCLRIW 482



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           TL GH+ W+T ++  P + +     + SSS+D ++ +W  T      G  ++ L GH+  
Sbjct: 193 TLAGHSKWITGLSWEPLHANPECRYVASSSKDGSVRIWDTTA-----GRCERILTGHTQS 247

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ +    DG    S S D+T+++W    G   R  + H
Sbjct: 248 VTCLRWGGDG-LLYSASQDRTIKVWRAHDGVLCRTLQGH 285



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH+  V  +A +P     + S S D T+  W L+ +      P     GH H++  +
Sbjct: 108 SLEGHSEAVISVAFSPT-GKYLASGSGDTTVRFWDLSTET-----PHFTCKGHRHWVLSI 161

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTT-RRFEDHTK 358
             S DG    SG  +  + LWD + GK   R    H+K
Sbjct: 162 SWSPDGKKLASGCKNGQILLWDPSTGKQVGRTLAGHSK 199



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 5/102 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH  WV  I+ +P     + S  ++  +++W    D +      + L GHS +I+ +
Sbjct: 150 TCKGHRHWVLSISWSPD-GKKLASGCKNGQILLW----DPSTGKQVGRTLAGHSKWITGL 204

Query: 248 V-----LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                  + +  Y  S S D ++R+WD  AG+  R    HT+
Sbjct: 205 SWEPLHANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQ 246



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 32/50 (64%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL 277
           ++ S+S+D+T+ VW+      + G+  + L GH H+++ + LS+D  YAL
Sbjct: 258 LLYSASQDRTIKVWRA-----HDGVLCRTLQGHGHWVNTMALSTD--YAL 300


>AK001320-1|BAA91621.1|  485|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10458 fis, clone NT2RP1001457, highly similar to
           Homo sapiens partial mRNA for beta-transducin family
           protein. ).
          Length = 485

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 38/77 (49%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P+ ++S S D TL +W    D+     P  R+ GH   I+ V+ S D     S S+DK++
Sbjct: 341 PERLVSGSDDFTLFLWSPAEDKK----PLTRMTGHQALINQVLFSPDSRIVASASFDKSI 396

Query: 302 RLWDLAAGKTTRRFEDH 352
           +LWD   GK       H
Sbjct: 397 KLWDGRTGKYLASLRGH 413



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   + Q+  +P    ++ S+S DK++ +W     +   G     L GH   +  + 
Sbjct: 368 MTGHQALINQVLFSPD-SRIVASASFDKSIKLW-----DGRTGKYLASLRGHVAAVYQIA 421

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D    +SGS D TL++WD+ A K       H
Sbjct: 422 WSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGH 455



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   +LRGH   V QIA +     +++S S D TL VW +   +    +P     GH+
Sbjct: 403 TGKYLASLRGHVAAVYQIAWSAD-SRLLVSGSSDSTLKVWDVKAQKLAMDLP-----GHA 456

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S DG    SG  DK LR+W
Sbjct: 457 DEVYAVDWSPDGQRVASGGKDKCLRIW 483



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           TL GH+ W+T ++  P + +     + SSS+D ++ +W  T      G  ++ L GH+  
Sbjct: 194 TLAGHSKWITGLSWEPLHANPECRYVASSSKDGSVRIWDTTA-----GRCERILTGHTQS 248

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ +    DG    S S D+T+++W    G   R  + H
Sbjct: 249 VTCLRWGGDG-LLYSASQDRTIKVWRAHDGVLCRTLQGH 286



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH+  V  +A +P     + S S D T+  W L+ +      P     GH H++  +
Sbjct: 109 SLEGHSEAVISVAFSPT-GKYLASGSGDTTVRFWDLSTET-----PHFTCKGHRHWVLSI 162

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTT-RRFEDHTK 358
             S DG    SG  +  + LWD + GK   R    H+K
Sbjct: 163 SWSPDGKKLASGCKNGQILLWDPSTGKQVGRTLAGHSK 200



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 5/102 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH  WV  I+ +P     + S  ++  +++W    D +      + L GHS +I+ +
Sbjct: 151 TCKGHRHWVLSISWSPD-GKKLASGCKNGQILLW----DPSTGKQVGRTLAGHSKWITGL 205

Query: 248 V-----LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                  + +  Y  S S D ++R+WD  AG+  R    HT+
Sbjct: 206 SWEPLHANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQ 247



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 32/50 (64%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL 277
           ++ S+S+D+T+ VW+      + G+  + L GH H+++ + LS+D  YAL
Sbjct: 259 LLYSASQDRTIKVWRA-----HDGVLCRTLQGHGHWVNTMALSTD--YAL 301


>AB209111-1|BAD92348.1|  487|Homo sapiens Notchless gene homolog
           variant protein.
          Length = 487

 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 38/77 (49%)
 Frame = +2

Query: 122 PDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           P+ ++S S D TL +W    D+     P  R+ GH   I+ V+ S D     S S+DK++
Sbjct: 343 PERLVSGSDDFTLFLWSPAEDKK----PLTRMTGHQALINQVLFSPDSRIVASASFDKSI 398

Query: 302 RLWDLAAGKTTRRFEDH 352
           +LWD   GK       H
Sbjct: 399 KLWDGRTGKYLASLRGH 415



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   + Q+  +P    ++ S+S DK++ +W     +   G     L GH   +  + 
Sbjct: 370 MTGHQALINQVLFSPD-SRIVASASFDKSIKLW-----DGRTGKYLASLRGHVAAVYQIA 423

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D    +SGS D TL++WD+ A K       H
Sbjct: 424 WSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGH 457



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   +LRGH   V QIA +     +++S S D TL VW +   +    +P     GH+
Sbjct: 405 TGKYLASLRGHVAAVYQIAWSAD-SRLLVSGSSDSTLKVWDVKAQKLAMDLP-----GHA 458

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S DG    SG  DK LR+W
Sbjct: 459 DEVYAVDWSPDGQRVASGGKDKCLRIW 485



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           TL GH+ W+T ++  P + +     + SSS+D ++ +W  T      G  ++ L GH+  
Sbjct: 196 TLAGHSKWITGLSWEPLHANPECRYVASSSKDGSVRIWDTTA-----GRCERILTGHTQS 250

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++ +    DG    S S D+T+++W    G   R  + H
Sbjct: 251 VTCLRWGGDG-LLYSASQDRTIKVWRAHDGVLCRTLQGH 288



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 1/98 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH+  V  +A +P     + S S D T+  W L+ +      P     GH H++  +
Sbjct: 111 SLEGHSEAVISVAFSPT-GKYLASGSGDTTVRFWDLSTET-----PHFTCKGHRHWVLSI 164

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTT-RRFEDHTK 358
             S DG    SG  +  + LWD + GK   R    H+K
Sbjct: 165 SWSPDGKKLASGCKNGQILLWDPSTGKQVGRTLAGHSK 202



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 5/102 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH  WV  I+ +P     + S  ++  +++W    D +      + L GHS +I+ +
Sbjct: 153 TCKGHRHWVLSISWSPD-GKKLASGCKNGQILLW----DPSTGKQVGRTLAGHSKWITGL 207

Query: 248 V-----LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
                  + +  Y  S S D ++R+WD  AG+  R    HT+
Sbjct: 208 SWEPLHANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQ 249



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 17/50 (34%), Positives = 32/50 (64%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL 277
           ++ S+S+D+T+ VW+      + G+  + L GH H+++ + LS+D  YAL
Sbjct: 261 LLYSASQDRTIKVWRA-----HDGVLCRTLQGHGHWVNTMALSTD--YAL 303


>U72342-1|AAC51111.1|  410|Homo sapiens platelet activating factor
           acetylhydrolase, brain isoform, 45 kDa subunit protein.
          Length = 410

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/102 (28%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  I+ +     ++ S S D T+ +W     E       + ++GH
Sbjct: 138 ETGDFERTLKGHTDSVQDISFDHS-GKLLASCSADMTIKLWDFQGFECI-----RTMHGH 191

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 192 DHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 233



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 31/98 (31%), Positives = 52/98 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D I+S+SRDKT+ +W++   +  Y +  K   GH  ++  V
Sbjct: 187 TMHGHDHNVSSVAIMPN-GDHIVSASRDKTIKMWEV---QTGYCV--KTFTGHREWVRMV 240

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG    S S D+T+R+W +A  +      +H  V
Sbjct: 241 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHV 278



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS SRDKT+ +W ++      G+    L GH +++  V+  S G + LS + DKTLR+W
Sbjct: 311 LLSGSRDKTIKMWDVST-----GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 365

Query: 311 DLAAGKTTRRFEDH 352
           D    +  +    H
Sbjct: 366 DYKNKRCMKTLNAH 379



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +  +      ILS + DKTL VW    D  N     K L  H HF++ +
Sbjct: 333 TLVGHDNWVRGVLFHSG-GKFILSCADDKTLRVW----DYKNKRC-MKTLNAHEHFVTSL 386

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  Y ++GS D+T+++W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRD------ENNYGI------PQ 208
           T  GH  WV  +  N     +I S S D+T+ VW + T++      E+ + +      P+
Sbjct: 229 TFTGHREWVRMVRPNQD-GTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPE 287

Query: 209 KRLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAG 325
                 S         S   G + LSGS DKT+++WD++ G
Sbjct: 288 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG 328



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   ++ V+     +  +S S D T+++WD   G   R  + HT
Sbjct: 99  PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHT 150


>L13387-1|AAA02882.1|  288|Homo sapiens Miller-Dieker lissencephaly
           protein protein.
          Length = 288

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/102 (28%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  I+ +     ++ S S D T+ +W     E       + ++GH
Sbjct: 16  ETGDFERTLKGHTDSVQDISFDHS-GKLLASCSADMTIKLWDFQGFECI-----RTMHGH 69

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 70  DHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 111



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 31/98 (31%), Positives = 52/98 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D I+S+SRDKT+ +W++   +  Y +  K   GH  ++  V
Sbjct: 65  TMHGHDHNVSSVAIMPN-GDHIVSASRDKTIKMWEV---QTGYCV--KTFTGHREWVRMV 118

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG    S S D+T+R+W +A  +      +H  V
Sbjct: 119 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHV 156



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/74 (32%), Positives = 39/74 (52%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS SRDKT+ +W ++      G+      GH +++  V+  S G + LS + DKTLR+W
Sbjct: 189 LLSGSRDKTIKMWDVST-----GMCLMTXVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 243

Query: 311 DLAAGKTTRRFEDH 352
           D    +  +    H
Sbjct: 244 DYKNKRCMKTLNAH 257



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 41/82 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH+ WV  +  +      ILS + DKTL VW    D  N     K L  H HF++ +
Sbjct: 211 TXVGHDNWVRGVLFHSG-GKFILSCADDKTLRVW----DYKNKRC-MKTLNAHEHFVTSL 264

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  Y ++GS D+T+++W+
Sbjct: 265 DFHKTAPYVVTGSVDQTVKVWE 286



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRD------ENNYGI------PQ 208
           T  GH  WV  +  N     +I S S D+T+ VW + T++      E+ + +      P+
Sbjct: 107 TFTGHREWVRMVRPNQD-GTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPE 165

Query: 209 KRLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAG 325
                 S         S   G + LSGS DKT+++WD++ G
Sbjct: 166 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG 206


>L13386-1|AAA02881.1|  410|Homo sapiens Miller-Dieker lissencephaly
           protein protein.
          Length = 410

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/102 (28%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  I+ +     ++ S S D T+ +W     E       + ++GH
Sbjct: 138 ETGDFERTLKGHTDSVQDISFDHS-GKLLASCSADMTIKLWDFQGFECI-----RTMHGH 191

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 192 DHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 233



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 31/98 (31%), Positives = 52/98 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D I+S+SRDKT+ +W++   +  Y +  K   GH  ++  V
Sbjct: 187 TMHGHDHNVSSVAIMPN-GDHIVSASRDKTIKMWEV---QTGYCV--KTFTGHREWVRMV 240

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG    S S D+T+R+W +A  +      +H  V
Sbjct: 241 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHV 278



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS SRDKT+ +W ++      G+    L GH +++  V+  S G + LS + DKTLR+W
Sbjct: 311 LLSGSRDKTIKMWDVST-----GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 365

Query: 311 DLAAGKTTRRFEDH 352
           D    +  +    H
Sbjct: 366 DYKNKRCMKTLNAH 379



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +  +      ILS + DKTL VW    D  N     K L  H HF++ +
Sbjct: 333 TLVGHDNWVRGVLFHSG-GKFILSCADDKTLRVW----DYKNKRC-MKTLNAHEHFVTSL 386

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  Y ++GS D+T+++W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRD------ENNYGI------PQ 208
           T  GH  WV  +  N     +I S S D+T+ VW + T++      E+ + +      P+
Sbjct: 229 TFTGHREWVRMVRPNQD-GTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPE 287

Query: 209 KRLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAG 325
                 S         S   G + LSGS DKT+++WD++ G
Sbjct: 288 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG 328



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   ++ V+     +  +S S D T+++WD   G   R  + HT
Sbjct: 99  PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHT 150


>L13385-1|AAA02880.1|  410|Homo sapiens Miller-Dieker lissencephaly
           protein protein.
          Length = 410

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/102 (28%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  I+ +     ++ S S D T+ +W     E       + ++GH
Sbjct: 138 ETGDFERTLKGHTDSVQDISFDHS-GKLLASCSADMTIKLWDFQGFECI-----RTMHGH 191

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 192 DHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 233



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 31/98 (31%), Positives = 52/98 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D I+S+SRDKT+ +W++   +  Y +  K   GH  ++  V
Sbjct: 187 TMHGHDHNVSSVAIMPN-GDHIVSASRDKTIKMWEV---QTGYCV--KTFTGHREWVRMV 240

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG    S S D+T+R+W +A  +      +H  V
Sbjct: 241 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHV 278



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS SRDKT+ +W ++      G+    L GH +++  V+  S G + LS + DKTLR+W
Sbjct: 311 LLSGSRDKTIKMWDVST-----GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 365

Query: 311 DLAAGKTTRRFEDH 352
           D    +  +    H
Sbjct: 366 DYKNKRCMKTLNAH 379



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +  +      ILS + DKTL VW    D  N     K L  H HF++ +
Sbjct: 333 TLVGHDNWVRGVLFHSG-GKFILSCADDKTLRVW----DYKNKRC-MKTLNAHEHFVTSL 386

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  Y ++GS D+T+++W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRD------ENNYGI------PQ 208
           T  GH  WV  +  N     +I S S D+T+ VW + T++      E+ + +      P+
Sbjct: 229 TFTGHREWVRMVRPNQD-GTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPE 287

Query: 209 KRLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAG 325
                 S         S   G + LSGS DKT+++WD++ G
Sbjct: 288 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG 328



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   ++ V+     +  +S S D T+++WD   G   R  + HT
Sbjct: 99  PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHT 150


>BX538346-1|CAD98141.1|  147|Homo sapiens hypothetical protein
           protein.
          Length = 147

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 27/98 (27%), Positives = 51/98 (52%), Gaps = 4/98 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSS----RDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L GH   VT++  +P +  M+ +S     +D T+ +W     E       + ++GH H +
Sbjct: 51  LSGHRSPVTRVIFHPVFSVMVSASEDATIKDMTIKLWDFQGFECI-----RTMHGHDHNV 105

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 106 SSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 143


>BC106004-1|AAI06005.1|  514|Homo sapiens pleiotropic regulator 1
           (PRL1 homolog, Arabidopsis) protein.
          Length = 514

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/99 (31%), Positives = 45/99 (45%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH GWV  IA  P      ++ S D+T+ +W L       G  +  L GH   
Sbjct: 195 KLYRVISGHLGWVRCIAVEPGN-QWFVTGSADRTIKIWDLAS-----GKLKLSLTGHIST 248

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V++S+   Y  S   DK ++ WDL   K  R +  H
Sbjct: 249 VRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGH 287



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYP--DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           L+    +R ++G ++ +     +P  D++++ SRD T  +W +    + +      L GH
Sbjct: 275 LEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVH-----TLSGH 329

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           ++ ++ V   +     ++GS D T+RLWDL AGKT     +H K
Sbjct: 330 TNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKK 373


>BC064638-1|AAH64638.1|  410|Homo sapiens platelet-activating factor
           acetylhydrolase, isoform Ib, alpha subunit 45kDa
           protein.
          Length = 410

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/102 (28%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  I+ +     ++ S S D T+ +W     E       + ++GH
Sbjct: 138 ETGDFERTLKGHTDSVQDISFDHS-GKLLASCSADMTIKLWDFQGFECI-----RTMHGH 191

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 192 DHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 233



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 31/98 (31%), Positives = 52/98 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D I+S+SRDKT+ +W++   +  Y +  K   GH  ++  V
Sbjct: 187 TMHGHDHNVSSVAIMPN-GDHIVSASRDKTIKMWEV---QTGYCV--KTFTGHREWVRMV 240

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG    S S D+T+R+W +A  +      +H  V
Sbjct: 241 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHV 278



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS SRDKT+ +W ++      G+    L GH +++  V+  S G + LS + DKTLR+W
Sbjct: 311 LLSGSRDKTIKMWDVST-----GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 365

Query: 311 DLAAGKTTRRFEDH 352
           D    +  +    H
Sbjct: 366 DYKNKRCMKTLNAH 379



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +  +      ILS + DKTL VW    D  N     K L  H HF++ +
Sbjct: 333 TLVGHDNWVRGVLFHSG-GKFILSCADDKTLRVW----DYKNKRC-MKTLNAHEHFVTSL 386

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  Y ++GS D+T+++W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRD------ENNYGI------PQ 208
           T  GH  WV  +  N     +I S S D+T+ VW + T++      E+ + +      P+
Sbjct: 229 TFTGHREWVRMVRPNQD-GTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPE 287

Query: 209 KRLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAG 325
                 S         S   G + LSGS DKT+++WD++ G
Sbjct: 288 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG 328



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   ++ V+     +  +S S D T+++WD   G   R  + HT
Sbjct: 99  PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHT 150


>BC020786-1|AAH20786.1|  505|Homo sapiens PLRG1 protein protein.
          Length = 505

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/99 (31%), Positives = 45/99 (45%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH GWV  IA  P      ++ S D+T+ +W L       G  +  L GH   
Sbjct: 186 KLYRVISGHLGWVRCIAVEPGN-QWFVTGSADRTIKIWDLAS-----GKLKLSLTGHIST 239

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V++S+   Y  S   DK ++ WDL   K  R +  H
Sbjct: 240 VRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGH 278



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYP--DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           L+    +R ++G ++ +     +P  D++++ SRD T  +W +    + +      L GH
Sbjct: 266 LEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVH-----TLSGH 320

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           ++ ++ V   +     ++GS D T+RLWDL AGKT     +H K
Sbjct: 321 TNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKK 364


>AF400434-1|AAK92483.1|  410|Homo sapiens platelet-activating factor
           acetyl hydrolase isoform Ib alpha subunit protein.
          Length = 410

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/102 (28%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  I+ +     ++ S S D T+ +W     E       + ++GH
Sbjct: 138 ETGDFERTLKGHTDSVQDISFDHS-GKLLASCSADMTIKLWDFQGFECI-----RTMHGH 191

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 192 DHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 233



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 31/98 (31%), Positives = 52/98 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D I+S+SRDKT+ +W++   +  Y +  K   GH  ++  V
Sbjct: 187 TMHGHDHNVSSVAIMPN-GDHIVSASRDKTIKMWEV---QTGYCV--KTFTGHREWVRMV 240

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG    S S D+T+R+W +A  +      +H  V
Sbjct: 241 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHV 278



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS SRDKT+ +W ++      G+    L GH +++  V+  S G + LS + DKTLR+W
Sbjct: 311 LLSGSRDKTIKMWDVST-----GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 365

Query: 311 DLAAGKTTRRFEDH 352
           D    +  +    H
Sbjct: 366 DYKNKRCMKTLNAH 379



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +  +      ILS + DKTL VW    D  N     K L  H HF++ +
Sbjct: 333 TLVGHDNWVRGVLFHSG-GKFILSCADDKTLRVW----DYKNKRC-MKTLNAHEHFVTSL 386

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  Y ++GS D+T+++W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRD------ENNYGI------PQ 208
           T  GH  WV  +  N     +I S S D+T+ VW + T++      E+ + +      P+
Sbjct: 229 TFTGHREWVRMVRPNQD-GTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPE 287

Query: 209 KRLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAG 325
                 S         S   G + LSGS DKT+++WD++ G
Sbjct: 288 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG 328



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   ++ V+     +  +S S D T+++WD   G   R  + HT
Sbjct: 99  PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHT 150


>AF208837-1|AAL34972.1|  410|Homo sapiens Miller-Dieker
           lissencephaly protein protein.
          Length = 410

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/102 (28%), Positives = 51/102 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  I+ +     ++ S S D T+ +W     E       + ++GH
Sbjct: 138 ETGDFERTLKGHTDSVQDISFDHS-GKLLASCSADMTIKLWDFQGFECI-----RTMHGH 191

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 192 DHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 233



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 31/98 (31%), Positives = 52/98 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D I+S+SRDKT+ +W++   +  Y +  K   GH  ++  V
Sbjct: 187 TMHGHDHNVSSVAIMPN-GDHIVSASRDKTIKMWEV---QTGYCV--KTFTGHREWVRMV 240

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG    S S D+T+R+W +A  +      +H  V
Sbjct: 241 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHV 278



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS SRDKT+ +W ++      G+    L GH +++  V+  S G + LS + DKTLR+W
Sbjct: 311 LLSGSRDKTIKMWDVST-----GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 365

Query: 311 DLAAGKTTRRFEDH 352
           D    +  +    H
Sbjct: 366 DYKNKRCMKTLNAH 379



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +  +      ILS + DKTL VW    D  N     K L  H HF++ +
Sbjct: 333 TLVGHDNWVRGVLFHSG-GKFILSCADDKTLRVW----DYKNKRC-MKTLNAHEHFVTSL 386

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  Y ++GS D+T+++W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRD------ENNYGI------PQ 208
           T  GH  WV  +  N     +I S S D+T+ VW + T++      E+ + +      P+
Sbjct: 229 TFTGHREWVRMVRPNQD-GTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPE 287

Query: 209 KRLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAG 325
                 S         S   G + LSGS DKT+++WD++ G
Sbjct: 288 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG 328



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   ++ V+     +  +S S D T+++WD   G   R  + HT
Sbjct: 99  PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHT 150


>AF044333-1|AAD09407.1|  514|Homo sapiens pleiotropic regulator 1
           protein.
          Length = 514

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 31/99 (31%), Positives = 45/99 (45%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL   + GH GWV  IA  P      ++ S D+T+ +W L       G  +  L GH   
Sbjct: 195 KLYRVISGHLGWVRCIAVEPGN-QWFVTGSADRTIKIWDLAS-----GKLKLSLTGHIST 248

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  V++S+   Y  S   DK ++ WDL   K  R +  H
Sbjct: 249 VRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGH 287



 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYP--DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           L+    +R ++G ++ +     +P  D++++ SRD T  +W +    + +      L GH
Sbjct: 275 LEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVH-----TLSGH 329

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           ++ ++ V   +     ++GS D T+RLWDL AGKT     +H K
Sbjct: 330 TNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKK 373


>X70476-1|CAA49900.1|  906|Homo sapiens subunit of coatomer complex
           protein.
          Length = 906

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 2/96 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH  +V QI  NPK  +   S+S D+T+ VW+L     N+      L GH   ++  D  
Sbjct: 140 GHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNF-----TLEGHEKGVNCIDYY 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              D  Y +SG+ D+ +++WD       +  E H +
Sbjct: 195 SGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQ 230


>BC000326-1|AAH00326.1|  906|Homo sapiens coatomer protein complex,
           subunit beta 2 (beta prime) protein.
          Length = 906

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 2/96 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH  +V QI  NPK  +   S+S D+T+ VW+L     N+      L GH   ++  D  
Sbjct: 140 GHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNF-----TLEGHEKGVNCIDYY 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              D  Y +SG+ D+ +++WD       +  E H +
Sbjct: 195 SGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQ 230


>AF208838-1|AAL34973.1|  410|Homo sapiens Miller-Dieker
           lissencephaly protein protein.
          Length = 410

 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 31/98 (31%), Positives = 52/98 (53%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D I+S+SRDKT+ +W++   +  Y +  K   GH  ++  V
Sbjct: 187 TMHGHDHNVSSVAIMPN-GDHIVSASRDKTIKMWEV---QTGYCV--KTFTGHREWVRMV 240

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
             + DG    S S D+T+R+W +A  +      +H  V
Sbjct: 241 RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHV 278



 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 31/102 (30%), Positives = 53/102 (51%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET     TL+GH   V  I+ +     ++ S S D T+   KL RD   +    + ++GH
Sbjct: 138 ETGDFERTLKGHTDSVQDISFDHS-GKLLASCSADMTI---KL-RDFQGFECI-RTMHGH 191

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V +  +G++ +S S DKT+++W++  G   + F  H
Sbjct: 192 DHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH 233



 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 25/74 (33%), Positives = 40/74 (54%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +LS SRDKT+ +W ++      G+    L GH +++  V+  S G + LS + DKTLR+W
Sbjct: 311 LLSGSRDKTIKMWDVST-----GMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVW 365

Query: 311 DLAAGKTTRRFEDH 352
           D    +  +    H
Sbjct: 366 DYKNKRCMKTLNAH 379



 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH+ WV  +  +      ILS + DKTL VW    D  N     K L  H HF++ +
Sbjct: 333 TLVGHDNWVRGVLFHSG-GKFILSCADDKTLRVW----DYKNKRC-MKTLNAHEHFVTSL 386

Query: 248 VLSSDGNYALSGSWDKTLRLWD 313
                  Y ++GS D+T+++W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 15/101 (14%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL-TRD------ENNYGI------PQ 208
           T  GH  WV  +  N     +I S S D+T+ VW + T++      E+ + +      P+
Sbjct: 229 TFTGHREWVRMVRPNQD-GTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPE 287

Query: 209 KRLYGHSHFISDVVLSSD--GNYALSGSWDKTLRLWDLAAG 325
                 S         S   G + LSGS DKT+++WD++ G
Sbjct: 288 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTG 328



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   ++ V+     +  +S S D T+++WD   G   R  + HT
Sbjct: 99  PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHT 150


>BC025379-1|AAH25379.1|  571|Homo sapiens SPAG16 protein protein.
          Length = 571

 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 30/86 (34%), Positives = 43/86 (50%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           + R TL GH   V  I   P + + +L+SS DKTL +W     +   GI ++ LYGH H 
Sbjct: 409 RCRCTLYGHTDSVNSIEFFP-FSNTLLTSSADKTLSIW-----DARTGICEQSLYGHMHS 462

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWD 313
           I+D +    G+   S       +LWD
Sbjct: 463 INDAIFDPRGHMIASCDACGVTKLWD 488



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 4/105 (3%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL----YG 223
           KL+   R H   V+ ++ +P + D+++S   D+   +WK+       G+P+  +    +G
Sbjct: 283 KLKNIFRLHELPVSCVSMHP-HKDILVSCGEDR---LWKVL------GLPKCNVLLTGFG 332

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H+ ++SD      G+   + S D T++LWDL  G     FE H++
Sbjct: 333 HTDWLSDCCFHPSGDKLATSSGDTTVKLWDLCKGDCILTFEGHSR 377



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 27/93 (29%), Positives = 42/93 (45%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH  W++    +P   D + +SS D T+ +W L +     G       GHS  +      
Sbjct: 332 GHTDWLSDCCFHPS-GDKLATSSGDTTVKLWDLCK-----GDCILTFEGHSRAVWSCTWH 385

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S GN+  S S DKT ++WD+ + +       HT
Sbjct: 386 SCGNFVASSSLDKTSKIWDVNSERCRCTLYGHT 418



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 26/86 (30%), Positives = 38/86 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH+  V    T     + + SSS DKT  +W +  +          LYGH+  ++ +
Sbjct: 371 TFEGHSRAVWS-CTWHSCGNFVASSSLDKTSKIWDVNSERCRC-----TLYGHTDSVNSI 424

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
                 N  L+ S DKTL +WD   G
Sbjct: 425 EFFPFSNTLLTSSADKTLSIWDARTG 450



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L GH +    VV S DG    SG  D T+R W
Sbjct: 538 KLMGHENEAHTVVFSHDGEILFSGGSDGTVRTW 570


>AF490390-1|AAM97147.1|  631|Homo sapiens sperm-associated WD repeat
           protein protein.
          Length = 631

 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 30/86 (34%), Positives = 43/86 (50%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           + R TL GH   V  I   P + + +L+SS DKTL +W     +   GI ++ LYGH H 
Sbjct: 469 RCRCTLYGHTDSVNSIEFFP-FSNTLLTSSADKTLSIW-----DARTGICEQSLYGHMHS 522

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWD 313
           I+D +    G+   S       +LWD
Sbjct: 523 INDAIFDPRGHMIASCDACGVTKLWD 548



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 4/105 (3%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL----YG 223
           KL+   R H   V+ ++  P + D+++S   D+   +WK+       G+P+  +    +G
Sbjct: 343 KLKNIFRLHELPVSCVSMQP-HKDILVSCGEDR---LWKVL------GLPKCNVLLTGFG 392

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H+ ++SD      G+   + S D T++LWDL  G     FE H++
Sbjct: 393 HTDWLSDCCFHPSGDKLATSSGDTTVKLWDLCTGDCILTFEGHSR 437



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 27/93 (29%), Positives = 41/93 (44%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH  W++    +P   D + +SS D T+ +W L       G       GHS  +      
Sbjct: 392 GHTDWLSDCCFHPS-GDKLATSSGDTTVKLWDLCT-----GDCILTFEGHSRAVWSCTWH 445

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S GN+  S S DKT ++WD+ + +       HT
Sbjct: 446 SCGNFVASSSLDKTSKIWDVNSERCRCTLYGHT 478



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 26/86 (30%), Positives = 38/86 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH+  V    T     + + SSS DKT  +W +  +          LYGH+  ++ +
Sbjct: 431 TFEGHSRAVWS-CTWHSCGNFVASSSLDKTSKIWDVNSERCRC-----TLYGHTDSVNSI 484

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
                 N  L+ S DKTL +WD   G
Sbjct: 485 EFFPFSNTLLTSSADKTLSIWDARTG 510



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L GH +    VV S DG    SG  D T+R W
Sbjct: 598 KLMGHENEAHTVVFSHDGEILFSGGSDGTVRTW 630


>AF310672-1|AAM63956.1|  631|Homo sapiens PF20 variant 1a protein.
          Length = 631

 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 30/86 (34%), Positives = 43/86 (50%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           + R TL GH   V  I   P + + +L+SS DKTL +W     +   GI ++ LYGH H 
Sbjct: 469 RCRCTLYGHTDSVNSIEFFP-FSNTLLTSSADKTLSIW-----DARTGICEQSLYGHMHS 522

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWD 313
           I+D +    G+   S       +LWD
Sbjct: 523 INDAIFDPRGHMIASCDACGVTKLWD 548



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 4/105 (3%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL----YG 223
           KL+   R H   V+ ++  P + D+++S   D+   +WK+       G+P+  +    +G
Sbjct: 343 KLKNIFRLHELPVSCVSMQP-HKDILVSCGEDR---LWKVL------GLPKCNVLLTGFG 392

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H+ ++SD      G+   + S D T++LWDL  G     FE H++
Sbjct: 393 HTDWLSDCCFHPSGDKLATSSGDTTVKLWDLCTGDCILTFEGHSR 437



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 27/93 (29%), Positives = 41/93 (44%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH  W++    +P   D + +SS D T+ +W L       G       GHS  +      
Sbjct: 392 GHTDWLSDCCFHPS-GDKLATSSGDTTVKLWDLCT-----GDCILTFEGHSRAVWSCTWH 445

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S GN+  S S DKT ++WD+ + +       HT
Sbjct: 446 SCGNFVASSSLDKTSKIWDVNSERCRCTLYGHT 478



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 26/86 (30%), Positives = 38/86 (44%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH+  V    T     + + SSS DKT  +W +  +          LYGH+  ++ +
Sbjct: 431 TFEGHSRAVWS-CTWHSCGNFVASSSLDKTSKIWDVNSERCRC-----TLYGHTDSVNSI 484

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
                 N  L+ S DKTL +WD   G
Sbjct: 485 EFFPFSNTLLTSSADKTLSIWDARTG 510



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L GH +    VV S DG    SG  D T+R W
Sbjct: 598 KLMGHENEAHTVVFSHDGEILFSGGSDGTVRTW 630


>AC008169-1|AAX93092.1|  106|Homo sapiens unknown protein.
          Length = 106

 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 30/86 (34%), Positives = 43/86 (50%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           + R TL GH   V  I   P + + +L+SS DKTL +W     +   GI ++ LYGH H 
Sbjct: 2   RCRCTLYGHTDSVNSIEFFP-FSNTLLTSSADKTLSIW-----DARTGICEQSLYGHMHS 55

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWD 313
           I+D +    G+   S       +LWD
Sbjct: 56  INDAIFDPRGHMIASCDACGVTKLWD 81



 Score = 33.5 bits (73), Expect = 0.63
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           LYGH+  ++ +      N  L+ S DKTL +WD   G
Sbjct: 7   LYGHTDSVNSIEFFPFSNTLLTSSADKTLSIWDARTG 43


>BC015887-1|AAH15887.1|  404|Homo sapiens WD repeat and SOCS
           box-containing 2 protein.
          Length = 404

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 48/94 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  ++  P    +++S+SRDKTL +W    D N +G   + L GH  ++    
Sbjct: 149 LSGHQDVVRDLSFTPSGSLILVSASRDKTLRIW----DLNKHGKQIQVLSGHLQWVYCCS 204

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S D +   S + +K++ LW + +    R+ E H
Sbjct: 205 ISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGH 238



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 26/97 (26%), Positives = 47/97 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH  WV   + +P    M+ S++ +K++ +W +     +Y + +K L GH   +    
Sbjct: 193 LSGHLQWVYCCSISPDC-SMLCSAAGEKSVFLWSM----RSYTLIRK-LEGHQSSVVSCD 246

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            S D    ++ S+D  + +WD   G+  R    HT+V
Sbjct: 247 FSPDSALLVTASYDTNVIMWDPYTGERLRSLH-HTQV 282


>AF229181-1|AAF71302.1|  404|Homo sapiens CS box-containing WD
           protein protein.
          Length = 404

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 48/94 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  ++  P    +++S+SRDKTL +W    D N +G   + L GH  ++    
Sbjct: 149 LSGHQDVVRDLSFTPSGSLILVSASRDKTLRIW----DLNKHGKQIQVLSGHLQWVYCCS 204

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S D +   S + +K++ LW + +    R+ E H
Sbjct: 205 ISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGH 238



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 26/97 (26%), Positives = 47/97 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH  WV   + +P    M+ S++ +K++ +W +     +Y + +K L GH   +    
Sbjct: 193 LSGHLQWVYCCSISPDC-SMLCSAAGEKSVFLWSM----RSYTLIRK-LEGHQSSVVSCD 246

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            S D    ++ S+D  + +WD   G+  R    HT+V
Sbjct: 247 FSPDSALLVTASYDTNVIMWDPYTGERLRSLH-HTQV 282


>AF163324-1|AAF80478.1|  404|Homo sapiens WSB-2 protein.
          Length = 404

 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 48/94 (51%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  ++  P    +++S+SRDKTL +W    D N +G   + L GH  ++    
Sbjct: 149 LSGHQDVVRDLSFTPSGSLILVSASRDKTLRIW----DLNKHGKQIQVLSGHLQWVYCCS 204

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +S D +   S + +K++ LW + +    R+ E H
Sbjct: 205 ISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGH 238



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 26/97 (26%), Positives = 47/97 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH  WV   + +P    M+ S++ +K++ +W +     +Y + +K L GH   +    
Sbjct: 193 LSGHLQWVYCCSISPDC-SMLCSAAGEKSVFLWSM----RSYTLIRK-LEGHQSSVVSCD 246

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            S D    ++ S+D  + +WD   G+  R    HT+V
Sbjct: 247 FSPDSALLVTASYDTNVIMWDPYTGERLRSLH-HTQV 282


>AL607085-2|CAI15166.1|  494|Homo sapiens WD repeat domain 37
           protein.
          Length = 494

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 29/90 (32%), Positives = 52/90 (57%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L  +L GH+  +T   T+P    ++++SSRD T  +W   RD + + +      GH
Sbjct: 311 ETSELVHSLTGHDQELTHCCTHPTQR-LVVTSSRDTTFRLWDF-RDPSIHSV--NVFQGH 366

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +  ++  V +  G+  +SGS D+T+++WDL
Sbjct: 367 TDTVTSAVFTV-GDNVVSGSDDRTVKVWDL 395


>AB023199-1|BAA76826.2|  502|Homo sapiens KIAA0982 protein protein.
          Length = 502

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 29/90 (32%), Positives = 52/90 (57%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +L  +L GH+  +T   T+P    ++++SSRD T  +W   RD + + +      GH
Sbjct: 319 ETSELVHSLTGHDQELTHCCTHPTQR-LVVTSSRDTTFRLWDF-RDPSIHSV--NVFQGH 374

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +  ++  V +  G+  +SGS D+T+++WDL
Sbjct: 375 TDTVTSAVFTV-GDNVVSGSDDRTVKVWDL 403



 Score = 30.7 bits (66), Expect = 4.4
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD----GNYALSGSWD 292
           D +  S +D+  +   ++ D     +P   L  H      VV++SD    G  A++ SWD
Sbjct: 255 DEVECSDKDEPDLDGDVSSDSPTIRVPLTSLKSHQ----GVVIASDWLVGGKQAVTASWD 310

Query: 293 KTLRLWDLAAGKTTRRFEDH 352
           +T  L+D+   +       H
Sbjct: 311 RTANLYDVETSELVHSLTGH 330


>BC107125-1|AAI07126.1|  248|Homo sapiens WDR86 protein protein.
          Length = 248

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++++ S D T  VW++       G   + L GH+  +  +VL + G+ A +GS D T+R 
Sbjct: 37  LLVTGSTDGTAKVWQVAS-----GCCHQTLRGHTGAVLCLVLDTPGHTAFTGSTDATIRA 91

Query: 308 WDLAAGKTTRRFEDH 352
           WD+ +G+  R F +H
Sbjct: 92  WDILSGEQLRVFREH 106



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 27/97 (27%), Positives = 40/97 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH G V  +  +        + S D T+  W +   E      Q R++   H  S +
Sbjct: 60  TLRGHTGAVLCLVLDTP-GHTAFTGSTDATIRAWDILSGE------QLRVF-REHRGSVI 111

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            L        SGS D+T++ W    G+  R F  H +
Sbjct: 112 CLELVNRLVYSGSADRTVKCWLADTGECVRTFTAHRR 148


>BC047921-1|AAH47921.1|  563|Homo sapiens WDR86 protein protein.
          Length = 563

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++++ S D T  VW++       G   + L GH+  +  +VL + G+ A +GS D T+R 
Sbjct: 352 LLVTGSTDGTAKVWQVAS-----GCCHQTLRGHTGAVLCLVLDTPGHTAFTGSTDATIRA 406

Query: 308 WDLAAGKTTRRFEDH 352
           WD+ +G+  R F +H
Sbjct: 407 WDILSGEQLRVFREH 421



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 13/44 (29%), Positives = 27/44 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+  ++ +++++  N   S S+D+T R+W +  G+ +R F  H
Sbjct: 282 GHTSIVNRILVAN--NQLFSSSYDRTARVWSVDKGQMSREFRGH 323



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 27/97 (27%), Positives = 40/97 (41%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TLRGH G V  +  +        + S D T+  W +   E      Q R++   H  S +
Sbjct: 375 TLRGHTGAVLCLVLDTP-GHTAFTGSTDATIRAWDILSGE------QLRVF-REHRGSVI 426

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            L        SGS D+T++ W    G+  R F  H +
Sbjct: 427 CLELVNRLVYSGSADRTVKCWLADTGECVRTFTAHRR 463



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 14/50 (28%), Positives = 25/50 (50%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           RL GH  +++   L  +  +  S   D T+R WD+  G+  + +  HT +
Sbjct: 239 RLGGHESYVTFCQLEDEAAFTCSA--DCTIRRWDVLTGQCLQVYRGHTSI 286



 Score = 30.7 bits (66), Expect = 4.4
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H   I+ + LS DG   L+GS D T RLW  A G+
Sbjct: 86  HRGGINWLSLSPDGQRLLTGSEDGTARLWSTADGQ 120


>AK125347-1|BAC86140.1|  277|Homo sapiens protein ( Homo sapiens
           cDNA FLJ43357 fis, clone NT2RP7013795, weakly  similar
           to VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1. ).
          Length = 277

 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++++ S D T  VW++       G   + L GH+  +  +VL + G+ A +GS D T+R 
Sbjct: 37  LLVTGSTDGTAKVWQVAS-----GCCHQTLRGHTGAVLCLVLDTPGHTAFTGSTDATIRA 91

Query: 308 WDLAAGKTTRRFEDH 352
           WD+ +G+  R F +H
Sbjct: 92  WDILSGEQLRVFREH 106


>EF011613-1|ABK41103.1|  513|Homo sapiens CDW3/SMU1 protein.
          Length = 513

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 29/96 (30%), Positives = 51/96 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR   R H+  VT ++ + K    ILS+S D+T+ +  L       G   K   GHS F+
Sbjct: 299 LRRFERAHSKGVTCLSFS-KDSSQILSASFDQTIRIHGLKS-----GKTLKEFRGHSSFV 352

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           ++   + DG+Y +S S D T+++W++   + +  F+
Sbjct: 353 NEATFTQDGHYIISASSDGTVKIWNMKTTECSNTFK 388



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 21/77 (27%), Positives = 42/77 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ + ++D  + VWK+   +      ++    HS  ++ +  S D +  LS S+D+T+R
Sbjct: 277 EMLATGAQDGKIKVWKIQSGQ----CLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIR 332

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  L +GKT + F  H+
Sbjct: 333 IHGLKSGKTLKEFRGHS 349


>BC127949-1|AAI27950.1|  314|Homo sapiens WD repeat domain 38
           protein.
          Length = 314

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 34/108 (31%), Positives = 48/108 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P    +  S+S D T+ +W + R +       + L GH   +  V 
Sbjct: 59  LGGHTGPVKFCRFSPD-GHLFASASCDCTVRLWDVARAKC-----LRVLKGHQRSVETVS 112

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVN 394
            S D     SG WDK + LWD+ +G+  R    H    Q+S F   VN
Sbjct: 113 FSPDSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVN 160



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/93 (33%), Positives = 42/93 (45%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H G V   A +P    M+L+ S D  +  W     E   G    RL GH+  +     S 
Sbjct: 20  HGGEVNSSAFSPD-GQMLLTGSEDGCVYGW-----ETRSGQLLWRLGGHTGPVKFCRFSP 73

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           DG+   S S D T+RLWD+A  K  R  + H +
Sbjct: 74  DGHLFASASCDCTVRLWDVARAKCLRVLKGHQR 106



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 25/82 (30%), Positives = 38/82 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   V  ++ +P     + S   DK +++W +       G   + L GH   I    
Sbjct: 101 LKGHQRSVETVSFSPD-SRQLASGGWDKRVMLWDVQS-----GQMLRLLVGHRDSIQSSD 154

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S   N   +GSWD T+R+WDL
Sbjct: 155 FSPTVNCLATGSWDSTVRIWDL 176



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 22/86 (25%), Positives = 41/86 (47%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+G ++ +  +     ++ S S DKT+ +WK T           +L GH  ++  + 
Sbjct: 188 LEGHSGNISCLCYSAS--GLLASGSWDKTIHIWKPTTSSLLI-----QLKGHVTWVKSIA 240

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
            S D  +  S  + + +++WD   GK
Sbjct: 241 FSPDELWLASAGYSRMVKVWDCNTGK 266


>BC110654-1|AAI10655.1|  513|Homo sapiens smu-1 suppressor of mec-8
           and unc-52 homolog (C. elegans) protein.
          Length = 513

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 29/96 (30%), Positives = 51/96 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR   R H+  VT ++ + K    ILS+S D+T+ +  L       G   K   GHS F+
Sbjct: 299 LRRFERAHSKGVTCLSFS-KDSSQILSASFDQTIRIHGLKS-----GKTLKEFRGHSSFV 352

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           ++   + DG+Y +S S D T+++W++   + +  F+
Sbjct: 353 NEATFTQDGHYIISASSDGTVKIWNMKTTECSNTFK 388



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 21/77 (27%), Positives = 42/77 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ + ++D  + VWK+   +      ++    HS  ++ +  S D +  LS S+D+T+R
Sbjct: 277 EMLATGAQDGKIKVWKIQSGQ----CLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIR 332

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  L +GKT + F  H+
Sbjct: 333 IHGLKSGKTLKEFRGHS 349


>BC002876-1|AAH02876.1|  513|Homo sapiens smu-1 suppressor of mec-8
           and unc-52 homolog (C. elegans) protein.
          Length = 513

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 29/96 (30%), Positives = 51/96 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR   R H+  VT ++ + K    ILS+S D+T+ +  L       G   K   GHS F+
Sbjct: 299 LRRFERAHSKGVTCLSFS-KDSSQILSASFDQTIRIHGLKS-----GKTLKEFRGHSSFV 352

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           ++   + DG+Y +S S D T+++W++   + +  F+
Sbjct: 353 NEATFTQDGHYIISASSDGTVKIWNMKTTECSNTFK 388



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 21/77 (27%), Positives = 42/77 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ + ++D  + VWK+   +      ++    HS  ++ +  S D +  LS S+D+T+R
Sbjct: 277 EMLATGAQDGKIKVWKIQSGQ----CLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIR 332

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  L +GKT + F  H+
Sbjct: 333 IHGLKSGKTLKEFRGHS 349


>AL354928-6|CAI39637.1|  314|Homo sapiens WD repeat domain 38
           protein.
          Length = 314

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 34/108 (31%), Positives = 48/108 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V     +P    +  S+S D T+ +W + R +       + L GH   +  V 
Sbjct: 59  LGGHTGPVKFCRFSPD-GHLFASASCDCTVRLWDVARAKC-----LRVLKGHQRSVETVS 112

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC*GVN 394
            S D     SG WDK + LWD+ +G+  R    H    Q+S F   VN
Sbjct: 113 FSPDSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVN 160



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/93 (33%), Positives = 42/93 (45%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H G V   A +P    M+L+ S D  +  W     E   G    RL GH+  +     S 
Sbjct: 20  HGGEVNSSAFSPD-GQMLLTGSEDGCVYGW-----ETRSGQLLWRLGGHTGPVKFCRFSP 73

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           DG+   S S D T+RLWD+A  K  R  + H +
Sbjct: 74  DGHLFASASCDCTVRLWDVARAKCLRVLKGHQR 106



 Score = 38.7 bits (86), Expect = 0.017
 Identities = 24/82 (29%), Positives = 37/82 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L+GH   V  ++ +P     + S   DK +++W +       G   + L GH   I    
Sbjct: 101 LKGHQRSVETVSFSPD-SRQLASGGWDKRVMLWDVQS-----GQMLRLLVGHRDSIQSSD 154

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
            S   N   +GSWD T+ +WDL
Sbjct: 155 FSPTVNCLATGSWDSTVHIWDL 176



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 21/86 (24%), Positives = 40/86 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+  ++ +  +     ++ S S DKT+ +WK T           +L GH  ++  + 
Sbjct: 188 LEGHSANISCLCYSAS--GLLASGSWDKTIHIWKPTTSSLLI-----QLKGHVTWVKSIA 240

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
            S D  +  S  + + +++WD   GK
Sbjct: 241 FSPDELWLASAGYSRMVKVWDCNTGK 266


>AL162590-6|CAI15554.1|  513|Homo sapiens smu-1 suppressor of mec-8
           and unc-52 homolog (C. elegans) protein.
          Length = 513

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 29/96 (30%), Positives = 51/96 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR   R H+  VT ++ + K    ILS+S D+T+ +  L       G   K   GHS F+
Sbjct: 299 LRRFERAHSKGVTCLSFS-KDSSQILSASFDQTIRIHGLKS-----GKTLKEFRGHSSFV 352

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           ++   + DG+Y +S S D T+++W++   + +  F+
Sbjct: 353 NEATFTQDGHYIISASSDGTVKIWNMKTTECSNTFK 388



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 21/77 (27%), Positives = 42/77 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ + ++D  + VWK+   +      ++    HS  ++ +  S D +  LS S+D+T+R
Sbjct: 277 EMLATGAQDGKIKVWKIQSGQ----CLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIR 332

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  L +GKT + F  H+
Sbjct: 333 IHGLKSGKTLKEFRGHS 349


>AK001667-1|BAA91822.1|  513|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10805 fis, clone NT2RP4000839, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1. ).
          Length = 513

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 29/96 (30%), Positives = 51/96 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           LR   R H+  VT ++ + K    ILS+S D+T+ +  L       G   K   GHS F+
Sbjct: 299 LRRFERAHSKGVTCLSFS-KDSSQILSASFDQTIRIHGLKS-----GKTLKEFRGHSSFV 352

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           ++   + DG+Y +S S D T+++W++   + +  F+
Sbjct: 353 NEATFTQDGHYIISASSDGTVKIWNMKTTECSNTFK 388



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 21/77 (27%), Positives = 42/77 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           +M+ + ++D  + VWK+   +      ++    HS  ++ +  S D +  LS S+D+T+R
Sbjct: 277 EMLATGAQDGKIKVWKIQSGQ----CLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIR 332

Query: 305 LWDLAAGKTTRRFEDHT 355
           +  L +GKT + F  H+
Sbjct: 333 IHGLKSGKTLKEFRGHS 349


>AF240696-1|AAF82746.1|  275|Homo sapiens WSB1 isoform 2 protein.
          Length = 275

 Score = 47.6 bits (108), Expect = 4e-05
 Identities = 34/110 (30%), Positives = 49/110 (44%)
 Frame = +2

Query: 23  FKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGI 202
           F P     E  KL   L  H   V  +   P    +++S+SRDKTL VW L +D+ N   
Sbjct: 4   FPPRVNEKEIGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL-KDDGNM-- 60

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             K L GH +++     S D +   S    K + LW++      R+ E H
Sbjct: 61  -MKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGH 109



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/91 (29%), Positives = 40/91 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV   A +P    M+ S    K + +W + +    Y + +K L GH H +    
Sbjct: 64  LRGHQNWVYSCAFSPD-SSMLCSVGASKAVFLWNMDK----YTMIRK-LEGHHHDVVACD 117

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    + S+D  + +WD   G     F
Sbjct: 118 FSPDGALLATASYDTRVYIWDPHNGDILMEF 148


>Y14153-1|CAA74572.1|  569|Homo sapiens beta-transducin repeats
           containing protein protein.
          Length = 569

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 380 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 431

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 432 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 472


>BC027994-1|AAH27994.1|  605|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 605

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 416 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 467

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 468 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 508


>BC026213-1|AAH26213.1|  529|Homo sapiens F-box and WD repeat domain
           containing 11 protein.
          Length = 529

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 340 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWSTSTCEF-----VRTLNGHKR 391

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 392 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 432


>AL627424-18|CAI41043.1|  569|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 569

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 380 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 431

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 432 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 472


>AL627424-17|CAI41042.1|  605|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 605

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 416 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 467

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 468 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 508


>AL445463-3|CAI12964.1|  569|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 569

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 380 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 431

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 432 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 472


>AL445463-2|CAI12963.1|  605|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 605

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 416 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 467

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 468 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 508


>AL133387-2|CAH70019.1|  569|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 569

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 380 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 431

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 432 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 472


>AL133387-1|CAH70020.1|  605|Homo sapiens beta-transducin repeat
           containing protein.
          Length = 605

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 416 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 467

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 468 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 508


>AF176022-1|AAF04528.1|  542|Homo sapiens F-box protein Fbw1b
           protein.
          Length = 542

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 353 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWSTSTCEF-----VRTLNGHKR 404

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 405 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 445


>AF129530-1|AAF04464.1|  569|Homo sapiens F-box protein Fbw1A
           protein.
          Length = 569

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 380 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 431

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 432 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 472


>AF101784-1|AAD08702.1|  605|Homo sapiens b-TRCP variant
           E3RS-IkappaB protein.
          Length = 605

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 416 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWNTSTCEF-----VRTLNGHKR 467

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 468 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 508


>AB033281-1|BAA92331.1|  542|Homo sapiens F-box and WD-repeats
           protein beta-TRCP2 isoform C protein.
          Length = 542

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 353 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWSTSTCEF-----VRTLNGHKR 404

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 405 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 445


>AB033280-1|BAA92330.1|  529|Homo sapiens F-box and WD-repeats
           protein beta-TRCP2 isoform B protein.
          Length = 529

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 340 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWSTSTCEF-----VRTLNGHKR 391

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 392 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 432


>AB033279-1|BAA92329.1|  508|Homo sapiens F-box and WD-repeats
           protein beta-TRCP2 isoform A protein.
          Length = 508

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 319 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWSTSTCEF-----VRTLNGHKR 370

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 371 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 411


>AB014596-1|BAA31671.1|  550|Homo sapiens KIAA0696 protein protein.
          Length = 550

 Score = 47.2 bits (107), Expect = 5e-05
 Identities = 34/103 (33%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 361 ITLRRVLVGHRAAVNVVDFDDKY---IVSASGDRTIKVWSTSTCEF-----VRTLNGHKR 412

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D T+RLWD+  G   R  E H ++
Sbjct: 413 GIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEEL 453


>EF011619-1|ABK41109.1|  478|Homo sapiens CDW9/WDR51B protein.
          Length = 478

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + ++S DK++ VW + R    Y      LY H+H++     S DG   +S S DKT+++W
Sbjct: 117 LATASEDKSIKVWSMYRQRFLYS-----LYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIW 171

Query: 311 DLAAGKTTRRFED 349
           D    +    F D
Sbjct: 172 DTTNKQCVNNFSD 184



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +T +  +P     + ++S D  L++W        Y     R  GH   ++ V  
Sbjct: 15  KGHKAAITSLDLSPN-GKQLATASWDTFLMLWNFKPHARAY-----RYVGHKDVVTSVQF 68

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  GN   S S D+T+RLW          F+ HT
Sbjct: 69  SPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHT 102



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 2/98 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGIPQKRLYGHSHFIS 241
           +L  H  WV     +P    +I+S S DKT+ +W  T  +  NN+        G ++F+ 
Sbjct: 139 SLYRHTHWVRCAKFSPD-GRLIVSCSEDKTIKIWDTTNKQCVNNF----SDSVGFANFVD 193

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               +  G    S   D+T+++WD+   K  + ++ H+
Sbjct: 194 ---FNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHS 228



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 5/85 (5%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR-----LYGHSHFIS 241
           GH   VT +  +P + +++ S+SRD+T+ +W          IP KR        H+  + 
Sbjct: 58  GHKDVVTSVQFSP-HGNLLASASRDRTVRLW----------IPDKRGKFSEFKAHTAPVR 106

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDL 316
            V  S+DG +  + S DK++++W +
Sbjct: 107 SVDFSADGQFLATASEDKSIKVWSM 131



 Score = 33.5 bits (73), Expect = 0.63
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 2/92 (2%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGIPQKRLYGHSHFISDVVLSS 259
           G+   +  NP     I S+  D+T+ VW +  ++   +Y +       HS  ++ +    
Sbjct: 187 GFANFVDFNPS-GTCIASAGSDQTVKVWDVRVNKLLQHYQV-------HSGGVNCISFHP 238

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            GNY ++ S D TL++ DL  G+     + HT
Sbjct: 239 SGNYLITASSDGTLKILDLLEGRLIYTLQGHT 270



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 15/47 (31%), Positives = 21/47 (44%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           GH   I+ + LS +G    + SWD  L LW+        R+  H  V
Sbjct: 16  GHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDV 62


>EF011617-1|ABK41107.1|  423|Homo sapiens CDW7/WDR12 protein.
          Length = 423

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 9/117 (7%)
 Frame = +2

Query: 32  FSKMSETLKLRG----TLRGHNGWVTQIATNPK--YPDMILSSSRDKTLIVWKLTRDENN 193
           + K S    L G    T+ GH   V  +A   K     ++LS+S D+T+++W+   + N 
Sbjct: 119 YDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNK 178

Query: 194 YGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                K L+   GH+  +  + +   G    SGSWDK L++W           E+ T
Sbjct: 179 V----KALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEEST 231



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           P   L GH   +S V L SD     S SWD T+R+WD+ +G
Sbjct: 249 PIVTLSGHMEAVSSV-LWSDAEEICSASWDHTIRVWDVESG 288



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L+ P +K    + L  +L  H GWVT +  +P +   ++S S D  + +W    D  +  
Sbjct: 323 LWDPRTKDGSLVSL--SLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLW----DTRSCK 376

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            P   L  H   +  V  +  G   LSG  D  L
Sbjct: 377 APLYDLAAHEDKVLSVDWTDTG-LLLSGGADNKL 409



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+ W++ I    ++   IL+ S DKT  +W L       G     + GH+  + DV    
Sbjct: 100 HDDWISSIKGAEEW---ILTGSYDKTSRIWSLE------GKSIMTIVGHTDVVKDVAWVK 150

Query: 260 DGNYA---LSGSWDKTLRLWD 313
             + +   LS S D+T+ LW+
Sbjct: 151 KDSLSCLLLSASMDQTILLWE 171



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +2

Query: 194 YGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           Y  PQ ++   H  +IS +  + +  + L+GS+DKT R+W L  GK+      HT V
Sbjct: 89  YTAPQPEQCMFHDDWISSIKGAEE--WILTGSYDKTSRIWSL-EGKSIMTIVGHTDV 142


>BC026080-1|AAH26080.1|  478|Homo sapiens WD repeat domain 51B
           protein.
          Length = 478

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + ++S DK++ VW + R    Y      LY H+H++     S DG   +S S DKT+++W
Sbjct: 117 LATASEDKSIKVWSMYRQRFLYS-----LYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIW 171

Query: 311 DLAAGKTTRRFED 349
           D    +    F D
Sbjct: 172 DTTNKQCVNNFSD 184



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +T +  +P     + ++S D  L++W        Y     R  GH   ++ V  
Sbjct: 15  KGHKAAITSLDLSPN-GKQLATASWDTFLMLWNFKPHARAY-----RYVGHKDVVTSVQF 68

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  GN   S S D+T+RLW          F+ HT
Sbjct: 69  SPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHT 102



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 2/98 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGIPQKRLYGHSHFIS 241
           +L  H  WV     +P    +I+S S DKT+ +W  T  +  NN+        G ++F+ 
Sbjct: 139 SLYRHTHWVRCAKFSPD-GRLIVSCSEDKTIKIWDTTNKQCVNNF----SDSVGFANFVD 193

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               +  G    S   D+T+++WD+   K  + ++ H+
Sbjct: 194 ---FNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHS 228



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 5/85 (5%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR-----LYGHSHFIS 241
           GH   VT +  +P + +++ S+SRD+T+ +W          IP KR        H+  + 
Sbjct: 58  GHKDVVTSVQFSP-HGNLLASASRDRTVRLW----------IPDKRGKFSEFKAHTAPVR 106

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDL 316
            V  S+DG +  + S DK++++W +
Sbjct: 107 SVDFSADGQFLATASEDKSIKVWSM 131



 Score = 33.5 bits (73), Expect = 0.63
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 2/92 (2%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGIPQKRLYGHSHFISDVVLSS 259
           G+   +  NP     I S+  D+T+ VW +  ++   +Y +       HS  ++ +    
Sbjct: 187 GFANFVDFNPS-GTCIASAGSDQTVKVWDVRVNKLLQHYQV-------HSGGVNCISFHP 238

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            GNY ++ S D TL++ DL  G+     + HT
Sbjct: 239 SGNYLITASSDGTLKILDLLEGRLIYTLQGHT 270



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 15/47 (31%), Positives = 21/47 (44%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           GH   I+ + LS +G    + SWD  L LW+        R+  H  V
Sbjct: 16  GHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDV 62


>BC008082-1|AAH08082.1|  423|Homo sapiens WD repeat domain 12
           protein.
          Length = 423

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 9/117 (7%)
 Frame = +2

Query: 32  FSKMSETLKLRG----TLRGHNGWVTQIATNPK--YPDMILSSSRDKTLIVWKLTRDENN 193
           + K S    L G    T+ GH   V  +A   K     ++LS+S D+T+++W+   + N 
Sbjct: 119 YDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNK 178

Query: 194 YGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                K L+   GH+  +  + +   G    SGSWDK L++W           E+ T
Sbjct: 179 V----KALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEEST 231



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           P   L GH   +S V L SD     S SWD T+R+WD+ +G
Sbjct: 249 PIVTLSGHMEAVSSV-LWSDAEEICSASWDHTIRVWDVESG 288



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L+ P +K    + L  +L  H GWVT +  +P +   ++S S D  + +W    D  +  
Sbjct: 323 LWDPRTKDGSLVSL--SLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLW----DTRSCK 376

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            P   L  H   +  V  +  G   LSG  D  L
Sbjct: 377 APLYDLAAHEDKVLSVDWTDTG-LLLSGGADNKL 409



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+ W++ I    ++   IL+ S DKT  +W L       G     + GH+  + DV    
Sbjct: 100 HDDWISSIKGAEEW---ILTGSYDKTSRIWSLE------GKSIMTIVGHTDVVKDVAWVK 150

Query: 260 DGNYA---LSGSWDKTLRLWD 313
             + +   LS S D+T+ LW+
Sbjct: 151 KDSLSCLLLSASMDQTILLWE 171



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +2

Query: 194 YGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           Y  PQ ++   H  +IS +  + +  + L+GS+DKT R+W L  GK+      HT V
Sbjct: 89  YTAPQPEQCMFHDDWISSIKGAEE--WILTGSYDKTSRIWSL-EGKSIMTIVGHTDV 142


>AK074772-1|BAC11198.1|  478|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90291 fis, clone NT2RP1001031, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1. ).
          Length = 478

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 23/73 (31%), Positives = 37/73 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + ++S DK++ VW + R    Y      LY H+H++     S DG   +S S DKT+++W
Sbjct: 117 LATASEDKSIKVWSMYRQRFLYS-----LYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIW 171

Query: 311 DLAAGKTTRRFED 349
           D    +    F D
Sbjct: 172 DTTNKQCVNNFSD 184



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +T +  +P     + ++S D  L++W        Y     R  GH   ++ V  
Sbjct: 15  KGHKAAITSLDLSPN-GKQLATASWDTFLMLWNFKPHARAY-----RYVGHKDVVTSVQF 68

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           S  GN   S S D+T+RLW          F+ HT
Sbjct: 69  SPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHT 102



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 2/98 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGIPQKRLYGHSHFIS 241
           +L  H  WV     +P    +I+S S DKT+ +W  T  +  NN+        G ++F+ 
Sbjct: 139 SLYRHTHWVRCAKFSPD-GRLIVSCSEDKTIKIWDTTNKQCVNNF----SDSVGFANFVD 193

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               +  G    S   D+T+++WD+   K  + ++ H+
Sbjct: 194 ---FNPSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHS 228



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 5/85 (5%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKR-----LYGHSHFIS 241
           GH   VT +  +P + +++ S+SRD+T+ +W          IP KR        H+  + 
Sbjct: 58  GHKDVVTSVQFSP-HGNLLASASRDRTVRLW----------IPDKRGKFSEFKAHTAPVR 106

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDL 316
            V  S+DG +  + S DK++++W +
Sbjct: 107 SVDFSADGQFLATASEDKSIKVWSM 131



 Score = 33.5 bits (73), Expect = 0.63
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 2/92 (2%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE--NNYGIPQKRLYGHSHFISDVVLSS 259
           G+   +  NP     I S+  D+T+ VW +  ++   +Y +       HS  ++ +    
Sbjct: 187 GFANFVDFNPS-GTCIASAGSDQTVKVWDVRVNKLLQHYQV-------HSGGVNCISFHP 238

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            GNY ++ S D TL++ DL  G+     + HT
Sbjct: 239 SGNYLITASSDGTLKILDLLEGRLIYTLQGHT 270



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 15/47 (31%), Positives = 21/47 (44%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           GH   I+ + LS +G    + SWD  L LW+        R+  H  V
Sbjct: 16  GHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDV 62


>AK022782-1|BAB14243.1|  423|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12720 fis, clone NT2RP1001302, weakly similar to
           MICROTUBULE-ASSOCIATED PROTEIN YTM1. ).
          Length = 423

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 9/117 (7%)
 Frame = +2

Query: 32  FSKMSETLKLRG----TLRGHNGWVTQIATNPK--YPDMILSSSRDKTLIVWKLTRDENN 193
           + K S    L G    T+ GH   V  +A   K     ++LS+S D+T+++W+   + N 
Sbjct: 119 YDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNK 178

Query: 194 YGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                K L+   GH+  +  + +   G    SGSWDK L++W           E+ T
Sbjct: 179 V----KALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEEST 231



 Score = 37.5 bits (83), Expect = 0.038
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           P   L GH   +S V L SD     S SWD T+R+WD+ +G
Sbjct: 249 PIVTLSGHMEAVSSV-LWSDAEEICSASWDHTIRVWDVGSG 288



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L+ P +K    + L  +L  H GWVT +  +P +   ++S S D  + +W    D  +  
Sbjct: 323 LWDPRTKDGSLVSL--SLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLW----DTRSCK 376

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            P   L  H   +  V  +  G   LSG  D  L
Sbjct: 377 APLYDLAAHEDKVLSVDWTDTG-LLLSGGADNKL 409



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+ W++ I    ++   IL+ S DKT  +W L       G     + GH+  + DV    
Sbjct: 100 HDDWISSIKGAEEW---ILTGSYDKTSRIWSLE------GKSIMTIVGHTDVVKDVAWVK 150

Query: 260 DGNYA---LSGSWDKTLRLWD 313
             + +   LS S D+T+ LW+
Sbjct: 151 KDSLSCLLLSASMDQTILLWE 171



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 18/53 (33%), Positives = 31/53 (58%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           P++ ++ H  +IS +  + +  + L+GS+DKT R+W L  GK+      HT V
Sbjct: 94  PEQCMF-HDDWISSIKGAEE--WILTGSYDKTSRIWSL-EGKSIMTIVGHTDV 142


>AK022781-1|BAB14242.1|  423|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12719 fis, clone NT2RP1001294, weakly similar to
           MICROTUBULE-ASSOCIATED PROTEIN YTM1. ).
          Length = 423

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 9/117 (7%)
 Frame = +2

Query: 32  FSKMSETLKLRG----TLRGHNGWVTQIATNPK--YPDMILSSSRDKTLIVWKLTRDENN 193
           + K S    L G    T+ GH   V  +A   K     ++LS+S D+T+++W+   + N 
Sbjct: 119 YDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNK 178

Query: 194 YGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                K L+   GH+  +  + +   G    SGSWDK L++W           E+ T
Sbjct: 179 V----KALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEEST 231



 Score = 37.5 bits (83), Expect = 0.038
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           P   L GH   +S V L SD     S SWD T+R+WD+ +G
Sbjct: 249 PIVTLSGHMEAVSSV-LWSDAEEICSASWDHTIRVWDVGSG 288



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L+ P +K    + L  +L  H GWVT +  +P +   ++S S D  + +W    D  +  
Sbjct: 323 LWDPRTKDGSLVSL--SLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLW----DTRSCK 376

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            P   L  H   +  V  +  G   LSG  D  L
Sbjct: 377 APLYDLAAHEDKVLSVDWTDTG-LLLSGGADNKL 409



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+ W++ I    ++   IL+ S DKT  +W L       G     + GH+  + DV    
Sbjct: 100 HDDWISSIKGAEEW---ILTGSYDKTSRIWSLE------GKSIMTIVGHTDVVKDVAWVK 150

Query: 260 DGNYA---LSGSWDKTLRLWD 313
             + +   LS S D+T+ LW+
Sbjct: 151 KDSLSCLLLSASMDQTILLWE 171



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 18/53 (33%), Positives = 31/53 (58%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           P++ ++ H  +IS +  + +  + L+GS+DKT R+W L  GK+      HT V
Sbjct: 94  PEQCMF-HDDWISSIKGAEE--WILTGSYDKTSRIWSL-EGKSIMTIVGHTDV 142


>AK001743-1|BAA91875.1|  423|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10881 fis, clone NT2RP4001927, weakly similar to
           MICROTUBULE-ASSOCIATED PROTEIN YTM1. ).
          Length = 423

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 9/117 (7%)
 Frame = +2

Query: 32  FSKMSETLKLRG----TLRGHNGWVTQIATNPK--YPDMILSSSRDKTLIVWKLTRDENN 193
           + K S    L G    T+ GH   V  +A   K     ++LS+S D+T+++W+   + N 
Sbjct: 119 YDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNK 178

Query: 194 YGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                K L+   GH+  +  + +   G    SGSWDK L++W           E+ T
Sbjct: 179 V----KALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEEST 231



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           P   L GH   +S V L SD     S SWD T+R+WD+ +G
Sbjct: 249 PIVTLSGHMEAVSSV-LWSDAEEICSASWDHTIRVWDVESG 288



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L+ P +K    + L  +L  H GWVT +  +P +   ++S S D  + +W    D  +  
Sbjct: 323 LWDPRTKDGSLVSL--SLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLW----DTRSCK 376

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            P   L  H   +  V  +  G   LSG  D  L
Sbjct: 377 APLYDLAAHEDKVLSVDWTDTG-LLLSGGADNKL 409



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+ W++ I    ++   IL+ S DKT  +W L       G     + GH+  + DV    
Sbjct: 100 HDDWISSIKGAEEW---ILTGSYDKTSRIWSLE------GKSIMTIVGHTDVVKDVAWVK 150

Query: 260 DGNYA---LSGSWDKTLRLWD 313
             + +   LS S D+T+ LW+
Sbjct: 151 KDSLSCLLLSASMDQTILLWE 171



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +2

Query: 194 YGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           Y  PQ ++   H  +IS +  + +  + L+GS+DKT R+W L  GK+      HT V
Sbjct: 89  YTAPQPEQCMFHDDWISSIKGAEE--WILTGSYDKTSRIWSL-EGKSIMTIVGHTDV 142


>AF242546-1|AAF60355.1|  423|Homo sapiens YTM1 protein.
          Length = 423

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 9/117 (7%)
 Frame = +2

Query: 32  FSKMSETLKLRG----TLRGHNGWVTQIATNPK--YPDMILSSSRDKTLIVWKLTRDENN 193
           + K S    L G    T+ GH   V  +A   K     ++LS+S D+T+++W+   + N 
Sbjct: 119 YDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNK 178

Query: 194 YGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                K L+   GH+  +  + +   G    SGSWDK L++W           E+ T
Sbjct: 179 V----KALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEEST 231



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           P   L GH   +S V L SD     S SWD T+R+WD+ +G
Sbjct: 249 PIVTLSGHMEAVSSV-LWSDAEEICSASWDHTIRVWDVESG 288



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L+ P +K    + L  +L  H GWVT +  +P +   ++S S D  + +W    D  +  
Sbjct: 323 LWDPRTKDGSMVSL--SLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLW----DTRSCK 376

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            P   L  H   +  V  +  G   LSG  D  L
Sbjct: 377 APLYDLAAHEDKVLSVDWTDTG-LLLSGGADNKL 409



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+ W++ I    ++   IL+ S DKT  +W L       G     + GH+  + DV    
Sbjct: 100 HDDWISSIKGAEEW---ILTGSYDKTSRIWSLE------GKSIMTIVGHTDVVKDVAWVK 150

Query: 260 DGNYA---LSGSWDKTLRLWD 313
             + +   LS S D+T+ LW+
Sbjct: 151 KDSLSCLLLSASMDQTILLWE 171



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +2

Query: 194 YGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           Y  PQ ++   H  +IS +  + +  + L+GS+DKT R+W L  GK+      HT V
Sbjct: 89  YTAPQPEQCMFHDDWISSIKGAEE--WILTGSYDKTSRIWSL-EGKSIMTIVGHTDV 142


>AC010900-2|AAY24287.1|  423|Homo sapiens unknown protein.
          Length = 423

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 9/117 (7%)
 Frame = +2

Query: 32  FSKMSETLKLRG----TLRGHNGWVTQIATNPK--YPDMILSSSRDKTLIVWKLTRDENN 193
           + K S    L G    T+ GH   V  +A   K     ++LS+S D+T+++W+   + N 
Sbjct: 119 YDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLSASMDQTILLWEWNVERNK 178

Query: 194 YGIPQKRLY---GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                K L+   GH+  +  + +   G    SGSWDK L++W           E+ T
Sbjct: 179 V----KALHCCRGHAGSVDSIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEEST 231



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           P   L GH   +S V L SD     S SWD T+R+WD+ +G
Sbjct: 249 PIVTLSGHMEAVSSV-LWSDAEEICSASWDHTIRVWDVESG 288



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 26/94 (27%), Positives = 40/94 (42%)
 Frame = +2

Query: 20  LFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG 199
           L+ P +K    + L  +L  H GWVT +  +P +   ++S S D  + +W    D  +  
Sbjct: 323 LWDPRTKDGSLVSL--SLTSHTGWVTSVKWSPTHEQQLISGSLDNIVKLW----DTRSCK 376

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
            P   L  H   +  V  +  G   LSG  D  L
Sbjct: 377 APLYDLAAHEDKVLSVDWTDTG-LLLSGGADNKL 409



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+ W++ I    ++   IL+ S DKT  +W L       G     + GH+  + DV    
Sbjct: 100 HDDWISSIKGAEEW---ILTGSYDKTSRIWSLE------GKSIMTIVGHTDVVKDVAWVK 150

Query: 260 DGNYA---LSGSWDKTLRLWD 313
             + +   LS S D+T+ LW+
Sbjct: 151 KDSLSCLLLSASMDQTILLWE 171



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
 Frame = +2

Query: 194 YGIPQ-KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           Y  PQ ++   H  +IS +  + +  + L+GS+DKT R+W L  GK+      HT V
Sbjct: 89  YTAPQPEQCMFHDDWISSIKGAEE--WILTGSYDKTSRIWSL-EGKSIMTIVGHTDV 142


>BC031227-1|AAH31227.2|  452|Homo sapiens WDR88 protein protein.
          Length = 452

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           + +SS DK L +W + T +  N G     + GH   +S    + D ++ +SG +D+T+ +
Sbjct: 314 LCTSSWDKNLKIWNVHTGEFRNCGACVTLMQGHEGSVSSCHFARDSSFLISGGFDRTVAI 373

Query: 308 WDLAAGKTTRRFEDH 352
           WD+A G      + H
Sbjct: 374 WDVAEGYRKLSLKGH 388



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 27/53 (50%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           IP K L GH H +S      D    LSGS+D T++LWD   G   R FE   K
Sbjct: 119 IPFKILSGHEHAVSTCHFCVDDTKLLSGSYDCTVKLWDPVDGSVVRDFEHRPK 171



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/82 (28%), Positives = 45/82 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH G V+      +    ++S   D+T+ +W +       G  +  L GH+ ++ DV 
Sbjct: 343 MQGHEGSVSSCHF-ARDSSFLISGGFDRTVAIWDVAE-----GYRKLSLKGHNDWVMDVA 396

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
           +S++  + LS S D+T+RLW++
Sbjct: 397 ISNNKKWILSASKDRTMRLWNI 418



 Score = 40.3 bits (90), Expect = 0.005
 Identities = 21/83 (25%), Positives = 40/83 (48%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   +T    +P     + S S D+ + +W +T       I +     HS+ IS+   + 
Sbjct: 255 HTRSITSCCFDPD-SQRVASVSLDRCIKIWDVTSQATLLTITK----AHSNAISNCCFTF 309

Query: 260 DGNYALSGSWDKTLRLWDLAAGK 328
            G++  + SWDK L++W++  G+
Sbjct: 310 SGHFLCTSSWDKNLKIWNVHTGE 332



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR-DENNYGIPQKRLYG 223
           +L+GHN WV  +A +      ILS+S+D+T+ +W +   DE    I  K+  G
Sbjct: 384 SLKGHNDWVMDVAIS-NNKKWILSASKDRTMRLWNIEEIDEIPLVIKYKKAVG 435



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +2

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
           ++ D +  ++ S+DKT+R WDL  GK
Sbjct: 179 ITGDSSRVIAASYDKTVRAWDLETGK 204


>AK131444-1|BAD18589.1|  472|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16579 fis, clone TESTI2049956, weakly  similar
           to Vegetatible incompatibility protein HET-E-1. ).
          Length = 472

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKL-TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           + +SS DK L +W + T +  N G     + GH   +S    + D ++ +SG +D+T+ +
Sbjct: 288 LCTSSWDKNLKIWNVHTGEFRNRGACVTLMQGHEGSVSSCHFARDSSFLISGGFDRTVAI 347

Query: 308 WDLAAGKTTRRFEDH 352
           WD+A G      + H
Sbjct: 348 WDVAEGYRKLSLKGH 362



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 27/53 (50%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           IP K L GH H +S      D    LSGS+D T++LWD   G   R FE   K
Sbjct: 93  IPFKILSGHEHAVSTCHFCVDDTKLLSGSYDCTVKLWDPVDGSVVRDFEHRPK 145



 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 23/82 (28%), Positives = 45/82 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           ++GH G V+      +    ++S   D+T+ +W +       G  +  L GH+ ++ DV 
Sbjct: 317 MQGHEGSVSSCHF-ARDSSFLISGGFDRTVAIWDVAE-----GYRKLSLKGHNDWVMDVA 370

Query: 251 LSSDGNYALSGSWDKTLRLWDL 316
           +S++  + LS S D+T+RLW++
Sbjct: 371 ISNNKKWILSASKDRTMRLWNI 392



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 22/87 (25%), Positives = 41/87 (47%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   +T    +P     + S S D+ + +W +T       I +     HS+ IS+   + 
Sbjct: 229 HTRSITSCCFDPD-SQRVASVSLDRCIKIWDVTSQATLLTITK----AHSNAISNCCFTF 283

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRR 340
            G++  + SWDK L++W++  G+   R
Sbjct: 284 SGHFLCTSSWDKNLKIWNVHTGEFRNR 310



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR-DENNYGIPQKRLYG 223
           +L+GHN WV  +A +      ILS+S+D+T+ +W +   DE    I  K+  G
Sbjct: 358 SLKGHNDWVMDVAIS-NNKKWILSASKDRTMRLWNIEEIDEIPLVIKYKKAVG 409



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +2

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGK 328
           ++ D +  ++ S+DKT+R WDL  GK
Sbjct: 153 ITGDSSRVIAASYDKTVRAWDLETGK 178


>AB010098-1|BAA36341.1|  475|Homo sapiens ClipinC protein.
          Length = 475

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G S L  P  +          + GH G V  I  NP   ++I S S D ++ +W++  
Sbjct: 55  AGGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPE 114

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVL-SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              + N       L+GHS  +  V    +  N   S  +D  + +W+L  G+  +  + H
Sbjct: 115 GGLKRNMTAALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCH 174

Query: 353 TKV 361
           T V
Sbjct: 175 TDV 177


>Y12781-1|CAA73319.1|  577|Homo sapiens transducin (beta) like 1
           protein protein.
          Length = 577

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + R     G+    L  H   +  V  S DG Y  SGS
Sbjct: 470 SNPNSNIMLASASFDSTVRLWDIER-----GVCTHTLTKHQEPVYSVAFSPDGKYLASGS 524

Query: 287 WDKTLRLWDLAAGKTTRRF 343
           +DK + +W+  +G     +
Sbjct: 525 FDKCVHIWNTQSGNLVHSY 543



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 29/104 (27%), Positives = 48/104 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G  +++   
Sbjct: 316 TEDGNLASTLGQHKGPIFALKWNRK-GNYILSAGVDKTTIIW-----DAHTGEAKQQFPF 369

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L   +  + F+ HT
Sbjct: 370 HSAPALDVDWQNNTTFA-SCSTDMCIHVCRLGCDRPVKTFQGHT 412


>BC052304-1|AAH52304.1|  577|Homo sapiens transducin (beta)-like
           1X-linked protein.
          Length = 577

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + R     G+    L  H   +  V  S DG Y  SGS
Sbjct: 470 SNPNSNIMLASASFDSTVRLWDIER-----GVCTHTLTKHQEPVYSVAFSPDGKYLASGS 524

Query: 287 WDKTLRLWDLAAGKTTRRF 343
           +DK + +W+  +G     +
Sbjct: 525 FDKCVHIWNTQSGNLVHSY 543



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 29/104 (27%), Positives = 48/104 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G  +++   
Sbjct: 316 TEDGNLASTLGQHKGPIFALKWNRK-GNYILSAGVDKTTIIW-----DAHTGEAKQQFPF 369

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L   +  + F+ HT
Sbjct: 370 HSAPALDVDWQNNTTFA-SCSTDMCIHVCRLGCDRPVKTFQGHT 412


>BC032708-1|AAH32708.1|  526|Homo sapiens TBL1X protein protein.
          Length = 526

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + R     G+    L  H   +  V  S DG Y  SGS
Sbjct: 419 SNPNSNIMLASASFDSTVRLWDIER-----GVCTHTLTKHQEPVYSVAFSPDGKYLASGS 473

Query: 287 WDKTLRLWDLAAGKTTRRF 343
           +DK + +W+  +G     +
Sbjct: 474 FDKCVHIWNTQSGNLVHSY 492



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 29/104 (27%), Positives = 48/104 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G  +++   
Sbjct: 265 TEDGNLASTLGQHKGPIFALKWNRK-GNYILSAGVDKTTIIW-----DAHTGEAKQQFPF 318

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L   +  + F+ HT
Sbjct: 319 HSAPALDVDWQNNTTFA-SCSTDMCIHVCRLGCDRPVKTFQGHT 361


>BC021110-1|AAH21110.1|  421|Homo sapiens WD repeat and SOCS
           box-containing 1 protein.
          Length = 421

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 32/101 (31%), Positives = 47/101 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL   L  H   V  +   P    +++S+SRDKTL VW L +D+ N     K L GH 
Sbjct: 159 TGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL-KDDGNM---MKVLRGHQ 214

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++     S D +   S    K + LW++      R+ E H
Sbjct: 215 NWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGH 255



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/91 (29%), Positives = 40/91 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV   A +P    M+ S    K + +W + +    Y + +K L GH H +    
Sbjct: 210 LRGHQNWVYSCAFSPD-SSMLCSVGASKAVFLWNMDK----YTMIRK-LEGHHHDVVACD 263

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    + S+D  + +WD   G     F
Sbjct: 264 FSPDGALLATASYDTRVYIWDPHNGDILMEF 294


>BC005870-1|AAH05870.1|  315|Homo sapiens mitogen-activated protein
           kinase organizer 1 protein.
          Length = 315

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/73 (34%), Positives = 36/73 (49%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L+   DKTL +W   R     G   +   GH + + D   S D +   SG  DK + LWD
Sbjct: 41  LTCGSDKTLKLWNPLR-----GTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWD 95

Query: 314 LAAGKTTRRFEDH 352
           +A+G+  R+F  H
Sbjct: 96  VASGQVVRKFRGH 108



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%)
 Frame = +2

Query: 200 IPQKRLYG---HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +PQKRL         +  V  + DGNY L+   DKTL+LW+   G   R +  H
Sbjct: 13  LPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGH 66



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 4/89 (4%)
 Frame = +2

Query: 59  LRGTL----RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           LRGTL     GH G+    A        + S   DK +++W +       G   ++  GH
Sbjct: 55  LRGTLLRTYSGH-GYEVLDAAGSFDNSSLCSGGGDKAVVLWDVAS-----GQVVRKFRGH 108

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +  ++ V  + +    LSGS D ++R WD
Sbjct: 109 AGKVNTVQFNEEATVILSGSIDSSIRCWD 137


>AK223195-1|BAD96915.1|  315|Homo sapiens mitogen-activated protein
           kinase organizer 1 variant protein.
          Length = 315

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 25/73 (34%), Positives = 36/73 (49%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L+   DKTL +W   R     G   +   GH + + D   S D +   SG  DK + LWD
Sbjct: 41  LTCGSDKTLKLWNPLR-----GTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWD 95

Query: 314 LAAGKTTRRFEDH 352
           +A+G+  R+F  H
Sbjct: 96  VASGQVVRKFRGH 108



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%)
 Frame = +2

Query: 200 IPQKRLYG---HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +PQKRL         +  V  + DGNY L+   DKTL+LW+   G   R +  H
Sbjct: 13  LPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGH 66



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 4/89 (4%)
 Frame = +2

Query: 59  LRGTL----RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           LRGTL     GH G+    A        + S   DK +++W +       G   ++  GH
Sbjct: 55  LRGTLLRTYSGH-GYEVLDAAGSFDNSSLCSGGGDKAVVLWDVAS-----GQVVRKFRGH 108

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +  ++ V  + +    LSGS D ++R WD
Sbjct: 109 AGKVNTVQFNEEATVILSGSIDSSIRCWD 137


>AK222721-1|BAD96441.1|  579|Homo sapiens pre-mRNA splicing factor
           17 variant protein.
          Length = 579

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 286 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSEAVRDICFN 341

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 342 TAGTQFLSAAYDRYLKLWDTETGQCISRF 370



 Score = 36.3 bits (80), Expect = 0.089
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)
 Frame = +2

Query: 185 ENNYGIPQKRLY-GH--SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +N + + +K+++ GH  + +   V  S D +Y +SG  +  L +WD    K   RF+ H 
Sbjct: 491 QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHD 550

Query: 356 KV 361
           KV
Sbjct: 551 KV 552


>AK074917-1|BAC11291.1|  421|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90436 fis, clone NT2RP3000820, weakly similar to
           PUTATIVE SERINE/THREONINE-PROTEIN KINASE PKWA (EC
           2.7.1.-). ).
          Length = 421

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 32/101 (31%), Positives = 47/101 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL   L  H   V  +   P    +++S+SRDKTL VW L +D+ N     K L GH 
Sbjct: 159 TGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL-KDDGNM---MKVLRGHQ 214

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++     S D +   S    K + LW++      R+ E H
Sbjct: 215 NWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGH 255



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/91 (29%), Positives = 40/91 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV   A +P    M+ S    K + +W + +    Y + +K L GH H +    
Sbjct: 210 LRGHQNWVYSCAFSPD-SSMLCSVGASKAVFLWNMDK----YTMIRK-LEGHHHDVVACD 263

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    + S+D  + +WD   G     F
Sbjct: 264 FSPDGALLATASYDTRVYIWDPHNGDILMEF 294


>AF112205-1|AAF17193.1|  421|Homo sapiens WSB-1 protein protein.
          Length = 421

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 32/101 (31%), Positives = 47/101 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL   L  H   V  +   P    +++S+SRDKTL VW L +D+ N     K L GH 
Sbjct: 159 TGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL-KDDGNM---MKVLRGHQ 214

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++     S D +   S    K + LW++      R+ E H
Sbjct: 215 NWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGH 255



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/91 (29%), Positives = 40/91 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV   A +P    M+ S    K + +W + +    Y + +K L GH H +    
Sbjct: 210 LRGHQNWVYSCAFSPD-SSMLCSVGASKAVFLWNMDK----YTMIRK-LEGHHHDVVACD 263

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    + S+D  + +WD   G     F
Sbjct: 264 FSPDGALLATASYDTRVYIWDPHNGDILMEF 294


>AF072880-1|AAD28808.1|  421|Homo sapiens SOCS box-containing WD
           protein SWiP-1 protein.
          Length = 421

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 32/101 (31%), Positives = 47/101 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL   L  H   V  +   P    +++S+SRDKTL VW L +D+ N     K L GH 
Sbjct: 159 TGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL-KDDGNM---MKVLRGHQ 214

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++     S D +   S    K + LW++      R+ E H
Sbjct: 215 NWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGH 255



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/91 (29%), Positives = 40/91 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV   A +P    M+ S    K + +W + +    Y + +K L GH H +    
Sbjct: 210 LRGHQNWVYSCAFSPD-SSMLCSVGASKAVFLWNMDK----YTMIRK-LEGHHHDVVACD 263

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    + S+D  + +WD   G     F
Sbjct: 264 FSPDGALLATASYDTRVYIWDPHNGDILMEF 294


>AF069313-1|AAD20954.2|  421|Homo sapiens WSB1 protein protein.
          Length = 421

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 32/101 (31%), Positives = 47/101 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL   L  H   V  +   P    +++S+SRDKTL VW L +D+ N     K L GH 
Sbjct: 159 TGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL-KDDGNM---MKVLRGHQ 214

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++     S D +   S    K + LW++      R+ E H
Sbjct: 215 NWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGH 255



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/91 (29%), Positives = 40/91 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV   A +P    M+ S    K + +W + +    Y + +K L GH H +    
Sbjct: 210 LRGHQNWVYSCAFSPD-SSMLCSVGASKAVFLWNMDK----YTMIRK-LEGHHHDVVACD 263

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    + S+D  + +WD   G     F
Sbjct: 264 FSPDGALLATASYDTRVYIWDPHNGDILMEF 294


>AB209608-1|BAD92845.1|  540|Homo sapiens transducin beta-like 1X
           variant protein.
          Length = 540

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + R     G+    L  H   +  V  S DG Y  SGS
Sbjct: 433 SNPNSNIMLASASFDSTVRLWDIER-----GVCTHTLTKHQEPVYSVAFSPDGKYLASGS 487

Query: 287 WDKTLRLWDLAAGKTTRRF 343
           +DK + +W+  +G     +
Sbjct: 488 FDKCVHIWNTQSGNLVHSY 506



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 29/104 (27%), Positives = 48/104 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G  +++   
Sbjct: 279 TEDGNLASTLGQHKGPIFALKWNRK-GNYILSAGVDKTTIIW-----DAHTGEAKQQFPF 332

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L   +  + F+ HT
Sbjct: 333 HSAPALDVDWQNNTTFA-SCSTDMCIHVCRLGCDRPVKTFQGHT 375


>BC126114-1|AAI26115.1|  579|Homo sapiens cell division cycle 40
           homolog (S. cerevisiae) protein.
          Length = 579

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 286 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSKAVRDICFN 341

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 342 TAGTQFLSAAYDRYLKLWDTETGQCISRF 370



 Score = 36.3 bits (80), Expect = 0.089
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)
 Frame = +2

Query: 185 ENNYGIPQKRLY-GH--SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +N + + +K+++ GH  + +   V  S D +Y +SG  +  L +WD    K   RF+ H 
Sbjct: 491 QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHD 550

Query: 356 KV 361
           KV
Sbjct: 551 KV 552


>BC117145-1|AAI17146.1|  579|Homo sapiens cell division cycle 40
           homolog (S. cerevisiae) protein.
          Length = 579

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 286 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSKAVRDICFN 341

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 342 TAGTQFLSAAYDRYLKLWDTETGQCISRF 370



 Score = 36.3 bits (80), Expect = 0.089
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)
 Frame = +2

Query: 185 ENNYGIPQKRLY-GH--SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +N + + +K+++ GH  + +   V  S D +Y +SG  +  L +WD    K   RF+ H 
Sbjct: 491 QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHD 550

Query: 356 KV 361
           KV
Sbjct: 551 KV 552


>BC026335-1|AAH26335.1|  475|Homo sapiens coronin, actin binding
           protein, 2B protein.
          Length = 475

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G S L  P  +          + GH G V  I  NP   ++I S S D ++ +W++  
Sbjct: 55  AGGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPE 114

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVL-SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              + N       L+GHS  +  V    +  N   S  +D  + +W+L  G+  +  + H
Sbjct: 115 GGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCH 174

Query: 353 TKV 361
           T V
Sbjct: 175 TDV 177


>AL671518-2|CAI13322.1|  579|Homo sapiens cell division cycle 40
           homolog (S. cerevisiae) protein.
          Length = 579

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 286 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSKAVRDICFN 341

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 342 TAGTQFLSAAYDRYLKLWDTETGQCISRF 370



 Score = 36.3 bits (80), Expect = 0.089
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)
 Frame = +2

Query: 185 ENNYGIPQKRLY-GH--SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +N + + +K+++ GH  + +   V  S D +Y +SG  +  L +WD    K   RF+ H 
Sbjct: 491 QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHD 550

Query: 356 KV 361
           KV
Sbjct: 551 KV 552


>AL671518-1|CAI13321.1|  539|Homo sapiens cell division cycle 40
           homolog (S. cerevisiae) protein.
          Length = 539

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 286 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSKAVRDICFN 341

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 342 TAGTQFLSAAYDRYLKLWDTETGQCISRF 370


>AL445068-1|CAI22519.1|  539|Homo sapiens cell division cycle 40
           homolog (S. cerevisiae) protein.
          Length = 539

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 286 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSKAVRDICFN 341

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 342 TAGTQFLSAAYDRYLKLWDTETGQCISRF 370


>AF061241-1|AAC25166.1|  542|Homo sapiens splicing factor hPRP17
           protein.
          Length = 542

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 249 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSKAVRDICFN 304

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 305 TAGTQFLSAAYDRYLKLWDTETGQCISRF 333



 Score = 36.3 bits (80), Expect = 0.089
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)
 Frame = +2

Query: 185 ENNYGIPQKRLY-GH--SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +N + + +K+++ GH  + +   V  S D +Y +SG  +  L +WD    K   RF+ H 
Sbjct: 454 QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHD 513

Query: 356 KV 361
           KV
Sbjct: 514 KV 515


>AF038392-1|AAC39730.1|  579|Homo sapiens pre-mRNA splicing factor
           protein.
          Length = 579

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 286 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSKAVRDICFN 341

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 342 TAGTQFLSAAYDRYLKLWDTETGQCISRF 370



 Score = 36.3 bits (80), Expect = 0.089
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)
 Frame = +2

Query: 185 ENNYGIPQKRLY-GH--SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +N + + +K+++ GH  + +   V  S D +Y +SG  +  L +WD    K   RF+ H 
Sbjct: 491 QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHD 550

Query: 356 KV 361
           KV
Sbjct: 551 KV 552


>AB208903-1|BAD92140.1|  501|Homo sapiens pre-mRNA splicing factor
           17 variant protein.
          Length = 501

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 24/89 (26%), Positives = 43/89 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V+ +   P    ++LS S D  + +W++  +        +   GHS  + D+  +
Sbjct: 285 GHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCL----RTFIGHSKAVRDICFN 340

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           + G   LS ++D+ L+LWD   G+   RF
Sbjct: 341 TAGTQFLSAAYDRYLKLWDTETGQCISRF 369


>AB023142-1|BAA76769.1|  479|Homo sapiens KIAA0925 protein protein.
          Length = 479

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 32/123 (26%), Positives = 52/123 (42%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G S L  P  +          + GH G V  I  NP   ++I S S D ++ +W++  
Sbjct: 59  AGGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPE 118

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVL-SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              + N       L+GHS  +  V    +  N   S  +D  + +W+L  G+  +  + H
Sbjct: 119 GGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCH 178

Query: 353 TKV 361
           T V
Sbjct: 179 TDV 181


>BC130473-1|AAI30474.1|  522|Homo sapiens transducin (beta)-like
           1Y-linked protein.
          Length = 522

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + +     G+    L  H   +  V  S DG Y  SGS
Sbjct: 417 SNPNSSIMLASASFDSTVRLWDVEQ-----GVCTHTLMKHQEPVYSVAFSPDGKYLASGS 471

Query: 287 WDKTLRLWDLAAGKTTRRFE 346
           +DK + +W+  +G     ++
Sbjct: 472 FDKYVHIWNTQSGSLVHSYQ 491



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GH-- 226
           LRGH   V   A NP   D++ S S D T  +W L  + N  G  Q  L       GH  
Sbjct: 175 LRGHESEVFICAWNP-VSDLLASGSGDSTARIWNLNENSNG-GSTQLVLRHCIREGGHDV 232

Query: 227 --SHFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  ++ +  +SDG     GS+D   R+W
Sbjct: 233 PSNKDVTSLDWNSDGTLLAMGSYDGFARIW 262



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GNY LS   DKT  +WD   G+  ++F  H+
Sbjct: 288 GNYVLSAGVDKTTIIWDAHTGEAKQQFPFHS 318



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 28/104 (26%), Positives = 47/104 (45%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + +LS+  DKT I+W     + + G  +++   
Sbjct: 263 TENGNLASTLGQHKGPIFALKWNKK-GNYVLSAGVDKTTIIW-----DAHTGEAKQQFPF 316

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L      + F+ HT
Sbjct: 317 HSAPALDVDWQNNMTFA-SCSTDMCIHVCRLGCDHPVKTFQGHT 359


>BC130471-1|AAI30472.1|  522|Homo sapiens transducin (beta)-like
           1Y-linked protein.
          Length = 522

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + +     G+    L  H   +  V  S DG Y  SGS
Sbjct: 417 SNPNSSIMLASASFDSTVRLWDVEQ-----GVCTHTLMKHQEPVYSVAFSPDGKYLASGS 471

Query: 287 WDKTLRLWDLAAGKTTRRFE 346
           +DK + +W+  +G     ++
Sbjct: 472 FDKYVHIWNTQSGSLVHSYQ 491



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GH-- 226
           LRGH   V   A NP   D++ S S D T  +W L  + N  G  Q  L       GH  
Sbjct: 175 LRGHESEVFICAWNP-VSDLLASGSGDSTARIWNLNENSNG-GSTQLVLRHCIREGGHDV 232

Query: 227 --SHFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  ++ +  +SDG     GS+D   R+W
Sbjct: 233 PSNKDVTSLDWNSDGTLLAMGSYDGFARIW 262



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GNY LS   DKT  +WD   G+  ++F  H+
Sbjct: 288 GNYVLSAGVDKTTIIWDAHTGEAKQQFPFHS 318



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 28/104 (26%), Positives = 47/104 (45%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + +LS+  DKT I+W     + + G  +++   
Sbjct: 263 TENGNLASTLGQHKGPIFALKWNKK-GNYVLSAGVDKTTIIW-----DAHTGEAKQQFPF 316

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L      + F+ HT
Sbjct: 317 HSAPALDVDWQNNMTFA-SCSTDMCIHVCRLGCDHPVKTFQGHT 359


>AY336089-1|AAR24619.1|  271|Homo sapiens proliferation-inducing
           gene 21 protein.
          Length = 271

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H+ WV+ +  +P   + +I+S   DK + VW L     N  +    + GH+ +++ V +S
Sbjct: 101 HSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLA----NCKLKTNHI-GHTGYLNTVTVS 155

Query: 257 SDGNYALSGSWDKTLRLWDLAAGK 328
            DG+   SG  D    LWDL  GK
Sbjct: 156 PDGSLCASGGKDGQAMLWDLNEGK 179



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +2

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHTK 358
           G   +R  GH+  +  V  SSD    +SGS DKT++LW+ L   K T + E H++
Sbjct: 49  GTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSE 103



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 2/77 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS--SDGNYALSGSWDKTLR 304
           I+S SRDKT+ +W  T     Y +  +    HS ++S V  S  S     +S  WDK ++
Sbjct: 74  IVSGSRDKTIKLWN-TLGVCKYTVQDE---SHSEWVSCVRFSPNSSNPIIVSCGWDKLVK 129

Query: 305 LWDLAAGKTTRRFEDHT 355
           +W+LA  K       HT
Sbjct: 130 VWNLANCKLKTNHIGHT 146


>AF332222-1|AAK13474.1|  522|Homo sapiens transducin beta-like 1
           protein.
          Length = 522

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + +     G+    L  H   +  V  S DG Y  SGS
Sbjct: 417 SNPNSSIMLASASFDSTVRLWDVEQ-----GVCTHTLMKHQEPVYSVAFSPDGKYLASGS 471

Query: 287 WDKTLRLWDLAAGKTTRRFE 346
           +DK + +W+  +G     ++
Sbjct: 472 FDKYVHIWNTQSGSLVHSYQ 491



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GH-- 226
           LRGH   V   A NP   D++ S S D T  +W L  + N  G  Q  L       GH  
Sbjct: 175 LRGHESEVFICAWNP-VSDLLASGSGDSTARIWNLNENSNG-GSTQLVLRHCIREGGHDV 232

Query: 227 --SHFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  ++ +  +SDG     GS+D   R+W
Sbjct: 233 PSNKDVTSLDWNSDGTLLAMGSYDGFARIW 262



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GNY LS   DKT  +WD   G+  ++F  H+
Sbjct: 288 GNYVLSAGVDKTTIIWDAHTGEAKQQFPFHS 318



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 28/104 (26%), Positives = 47/104 (45%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + +LS+  DKT I+W     + + G  +++   
Sbjct: 263 TENGNLASTLGQHKGPIFALKWNKK-GNYVLSAGVDKTTIIW-----DAHTGEAKQQFPF 316

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L      + F+ HT
Sbjct: 317 HSAPALDVDWQNNMTFA-SCSTDMCIHVCRLGCDHPVKTFQGHT 359


>AF332221-1|AAK13473.1|  522|Homo sapiens transducin beta-like 1
           protein.
          Length = 522

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + +     G+    L  H   +  V  S DG Y  SGS
Sbjct: 417 SNPNSSIMLASASFDSTVRLWDVEQ-----GVCTHTLMKHQEPVYSVAFSPDGKYLASGS 471

Query: 287 WDKTLRLWDLAAGKTTRRFE 346
           +DK + +W+  +G     ++
Sbjct: 472 FDKYVHIWNTQSGSLVHSYQ 491



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GH-- 226
           LRGH   V   A NP   D++ S S D T  +W L  + N  G  Q  L       GH  
Sbjct: 175 LRGHESEVFICAWNP-VSDLLASGSGDSTARIWNLNENSNG-GSTQLVLRHCIREGGHDV 232

Query: 227 --SHFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  ++ +  +SDG     GS+D   R+W
Sbjct: 233 PSNKDVTSLDWNSDGTLLAMGSYDGFARIW 262



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GNY LS   DKT  +WD   G+  ++F  H+
Sbjct: 288 GNYVLSAGVDKTTIIWDAHTGEAKQQFPFHS 318



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 28/104 (26%), Positives = 47/104 (45%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + +LS+  DKT I+W     + + G  +++   
Sbjct: 263 TENGNLASTLGQHKGPIFALKWNKK-GNYVLSAGVDKTTIIW-----DAHTGEAKQQFPF 316

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L      + F+ HT
Sbjct: 317 HSAPALDVDWQNNMTFA-SCSTDMCIHVCRLGCDHPVKTFQGHT 359


>AF332220-1|AAK13472.1|  522|Homo sapiens transducin beta-like 1
           protein.
          Length = 522

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +2

Query: 107 TNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
           +NP    M+ S+S D T+ +W + +     G+    L  H   +  V  S DG Y  SGS
Sbjct: 417 SNPNSSIMLASASFDSTVRLWDVEQ-----GVCTHTLMKHQEPVYSVAFSPDGKYLASGS 471

Query: 287 WDKTLRLWDLAAGKTTRRFE 346
           +DK + +W+  +G     ++
Sbjct: 472 FDKYVHIWNTQSGSLVHSYQ 491



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 10/90 (11%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GH-- 226
           LRGH   V   A NP   D++ S S D T  +W L  + N  G  Q  L       GH  
Sbjct: 175 LRGHESEVFICAWNP-VSDLLASGSGDSTARIWNLNENSNG-GSTQLVLRHCIREGGHDV 232

Query: 227 --SHFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  ++ +  +SDG     GS+D   R+W
Sbjct: 233 PSNKDVTSLDWNSDGTLLAMGSYDGFARIW 262



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GNY LS   DKT  +WD   G+  ++F  H+
Sbjct: 288 GNYVLSAGVDKTTIIWDAHTGEAKQQFPFHS 318



 Score = 31.5 bits (68), Expect = 2.5
 Identities = 28/104 (26%), Positives = 47/104 (45%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +E   L  TL  H G +  +  N K  + +LS+  DKT I+W     + + G  +++   
Sbjct: 263 TENGNLASTLGQHKGPIFALKWNKK-GNYVLSAGVDKTTIIW-----DAHTGEAKQQFPF 316

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS    DV   ++  +A S S D  + +  L      + F+ HT
Sbjct: 317 HSAPALDVDWQNNMTFA-SCSTDMCIHVCRLGCDHPVKTFQGHT 359


>AL121990-7|CAI22015.1|  589|Homo sapiens TAF5-like RNA polymerase
           II, p300/CBP-associated factor (PCAF)-associated facto
           protein.
          Length = 589

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 29/93 (31%), Positives = 40/93 (43%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +  +P Y     S S D+T  +W   R       P +   GH   +  V  
Sbjct: 381 QGHAYPVWDLDISP-YSLYFASGSHDRTARLWSFDRT-----YPLRIYAGHLADVDCVKF 434

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS DKT+RLW    G + R F  H
Sbjct: 435 HPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGH 467



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 32/118 (27%), Positives = 48/118 (40%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           ASG             T  LR    GH   V  +  +P   + + + S DKT+ +W   +
Sbjct: 400 ASGSHDRTARLWSFDRTYPLR-IYAGHLADVDCVKFHPN-SNYLATGSTDKTVRLWSAQQ 457

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                G   +   GH   +  +  S +G Y  S   D+ L+LWDLA+G   +    HT
Sbjct: 458 -----GNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHT 510



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G V  +A +P     + S+  D+ L +W L       G   K L GH+  I+ +  S
Sbjct: 466 GHRGPVLSLAFSPN-GKYLASAGEDQRLKLWDLAS-----GTLYKELRGHTDNITSLTFS 519

Query: 257 SDGNYALSGSWDKTLRLWDL 316
            D     S S D ++R+WD+
Sbjct: 520 PDSGLIASASMDNSVRVWDI 539



 Score = 33.1 bits (72), Expect = 0.83
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++N G   K L GH   +      +D +  LS S D ++R WDL +   T  ++ H
Sbjct: 327 EDDNAGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGH 383


>AJ009770-1|CAA08816.1|  260|Homo sapiens putative transcription
           factor protein.
          Length = 260

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 29/93 (31%), Positives = 40/93 (43%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +  +P Y     S S D+T  +W   R       P +   GH   +  V  
Sbjct: 52  QGHAYPVWDLDISP-YSLYFASGSHDRTARLWSFDRT-----YPLRIYAGHLADVDCVKF 105

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS DKT+RLW    G + R F  H
Sbjct: 106 HPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGH 138



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 32/118 (27%), Positives = 48/118 (40%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           ASG             T  LR    GH   V  +  +P   + + + S DKT+ +W   +
Sbjct: 71  ASGSHDRTARLWSFDRTYPLR-IYAGHLADVDCVKFHPN-SNYLATGSTDKTVRLWSAQQ 128

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                G   +   GH   +  +  S +G Y  S   D+ L+LWDLA+G   +    HT
Sbjct: 129 -----GNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHT 181



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G V  +A +P     + S+  D+ L +W L       G   K L GH+  I+ +  S
Sbjct: 137 GHRGPVLSLAFSPN-GKYLASAGEDQRLKLWDLAS-----GTLYKELRGHTDNITSLTFS 190

Query: 257 SDGNYALSGSWDKTLRLWDL 316
            D     S S D ++R+WD+
Sbjct: 191 PDSGLIASASMDNSVRVWDI 210



 Score = 31.1 bits (67), Expect = 3.3
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = +2

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N G   K L GH   +      +D +  LS S D ++R WDL +   T  ++ H
Sbjct: 1   NAGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGH 54


>AF069736-1|AAC39906.1|  589|Homo sapiens PCAF associated factor 65
           beta protein.
          Length = 589

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 29/93 (31%), Positives = 40/93 (43%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   V  +  +P Y     S S D+T  +W   R       P +   GH   +  V  
Sbjct: 381 QGHAYPVWDLDISP-YSLYFASGSHDRTARLWSFDRT-----YPLRIYAGHLADVDCVKF 434

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS DKT+RLW    G + R F  H
Sbjct: 435 HPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGH 467



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 32/118 (27%), Positives = 48/118 (40%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           ASG             T  LR    GH   V  +  +P   + + + S DKT+ +W   +
Sbjct: 400 ASGSHDRTARLWSFDRTYPLR-IYAGHLADVDCVKFHPN-SNYLATGSTDKTVRLWSAQQ 457

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                G   +   GH   +  +  S +G Y  S   D+ L+LWDLA+G   +    HT
Sbjct: 458 -----GNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHT 510



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G V  +A +P     + S+  D+ L +W L       G   K L GH+  I+ +  S
Sbjct: 466 GHRGPVLSLAFSPN-GKYLASAGEDQRLKLWDLAS-----GTLYKELRGHTDNITSLTFS 519

Query: 257 SDGNYALSGSWDKTLRLWDL 316
            D     S S D ++R+WD+
Sbjct: 520 PDSGLIASASMDNSVRVWDI 539



 Score = 33.1 bits (72), Expect = 0.83
 Identities = 17/57 (29%), Positives = 28/57 (49%)
 Frame = +2

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++N G   K L GH   +      +D +  LS S D ++R WDL +   T  ++ H
Sbjct: 327 EDDNAGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGH 383


>BT020045-1|AAV38848.1|  350|Homo sapiens unr-interacting protein
           protein.
          Length = 350

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 29/97 (29%), Positives = 41/97 (42%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           KP  +  +T    GT  GH G V     N K      +++ D T  VW     +      
Sbjct: 40  KPMLRQGDTGDWIGTFLGHKGAVWGATLN-KDATKAATAAADFTAKVWDAVSGD------ 92

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +     H H +  V  + D NY L+G  DK LR++DL
Sbjct: 93  ELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDL 129



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/55 (41%), Positives = 27/55 (49%)
 Frame = +2

Query: 167 WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           +KL + + N G   +   GH   I  V  S DG    SGS D TLRLW    GKT
Sbjct: 245 FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKT 299



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L+  +DK L ++ L + E       K + GH+  I   +  S+    LS   DKT+RLW
Sbjct: 115 LLTGGQDKLLRIYDLNKPEAE----PKEISGHTSGIKKALWCSEDKQILSAD-DKTVRLW 169

Query: 311 DLA 319
           D A
Sbjct: 170 DHA 172


>BT020044-1|AAV38847.1|  350|Homo sapiens unr-interacting protein
           protein.
          Length = 350

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 29/97 (29%), Positives = 41/97 (42%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           KP  +  +T    GT  GH G V     N K      +++ D T  VW     +      
Sbjct: 40  KPMLRQGDTGDWIGTFLGHKGAVWGATLN-KDATKAATAAADFTAKVWDAVSGD------ 92

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +     H H +  V  + D NY L+G  DK LR++DL
Sbjct: 93  ELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDL 129



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/55 (41%), Positives = 27/55 (49%)
 Frame = +2

Query: 167 WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           +KL + + N G   +   GH   I  V  S DG    SGS D TLRLW    GKT
Sbjct: 245 FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKT 299



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L+  +DK L ++ L + E       K + GH+  I   +  S+    LS   DKT+RLW
Sbjct: 115 LLTGGQDKLLRIYDLNKPEAE----PKEISGHTSGIKKALWCSEDKQILSAD-DKTVRLW 169

Query: 311 DLA 319
           D A
Sbjct: 170 DHA 172


>BC117246-1|AAI17247.1|  707|Homo sapiens F-box and WD repeat domain
           containing 7 protein.
          Length = 707

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 410 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 459

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 460 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 492



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 370 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 422

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 423 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 461



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 448 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 499

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 500 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 541



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 537 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 580


>BC117244-1|AAI17245.1|  707|Homo sapiens F-box and WD repeat domain
           containing 7 protein.
          Length = 707

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 410 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 459

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 460 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 492



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 370 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 422

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 423 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 461



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 448 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 499

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 500 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 541



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 537 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 580


>BC062306-1|AAH62306.1|  350|Homo sapiens serine/threonine kinase
           receptor associated protein protein.
          Length = 350

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 29/97 (29%), Positives = 41/97 (42%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           KP  +  +T    GT  GH G V     N K      +++ D T  VW     +      
Sbjct: 40  KPMLRQGDTGDWIGTFLGHKGAVWGATLN-KDATKAATAAADFTAKVWDAVSGD------ 92

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +     H H +  V  + D NY L+G  DK LR++DL
Sbjct: 93  ELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDL 129



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/55 (41%), Positives = 27/55 (49%)
 Frame = +2

Query: 167 WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           +KL + + N G   +   GH   I  V  S DG    SGS D TLRLW    GKT
Sbjct: 245 FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKT 299



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L+  +DK L ++ L + E       K + GH+  I   +  S+    LS   DKT+RLW
Sbjct: 115 LLTGGQDKLLRIYDLNKPEAE----PKEISGHTSGIKKALWCSEDKQILSAD-DKTVRLW 169

Query: 311 DLA 319
           D A
Sbjct: 170 DHA 172


>BC037320-1|AAH37320.1|  621|Homo sapiens FBXW7 protein protein.
          Length = 621

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 324 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 373

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 374 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 406



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 30/101 (29%), Positives = 43/101 (42%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 284 LKSPKVLNGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 336

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 337 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 375



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 362 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 413

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 414 HVAAVRCV--RYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 455



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 451 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 494


>BC002342-1|AAH02342.1|  474|Homo sapiens coronin, actin binding
           protein, 1C protein.
          Length = 474

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 3/119 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH G V  I   P    +I S S D T++VW++  
Sbjct: 53  SGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPE 112

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFED 349
           +     +  P   L GHS  +  V       N  LS   D  + +W++  G+     +D
Sbjct: 113 NGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDD 171


>BC000162-1|AAH00162.1|  350|Homo sapiens serine/threonine kinase
           receptor associated protein protein.
          Length = 350

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 29/97 (29%), Positives = 41/97 (42%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           KP  +  +T    GT  GH G V     N K      +++ D T  VW     +      
Sbjct: 40  KPMLRQGDTGDWIGTFLGHKGAVWGATLN-KDATKAATAAADFTAKVWDAVSGD------ 92

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +     H H +  V  + D NY L+G  DK LR++DL
Sbjct: 93  ELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDL 129



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/55 (41%), Positives = 27/55 (49%)
 Frame = +2

Query: 167 WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           +KL + + N G   +   GH   I  V  S DG    SGS D TLRLW    GKT
Sbjct: 245 FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKT 299



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L+  +DK L ++ L + E       K + GH+  I   +  S+    LS   DKT+RLW
Sbjct: 115 LLTGGQDKLLRIYDLNKPEAE----PKEISGHTSGIKKALWCSEDKQILSAD-DKTVRLW 169

Query: 311 DLA 319
           D A
Sbjct: 170 DHA 172


>AY049984-1|AAL07271.1|  707|Homo sapiens F-box protein CDC4
           protein.
          Length = 707

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 410 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 459

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 460 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 492



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 370 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 422

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 423 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 461



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 448 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 499

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 500 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 541



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 537 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 580


>AY049776-1|AAL15433.1|  350|Homo sapiens unr-interacting protein
           protein.
          Length = 350

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 29/97 (29%), Positives = 41/97 (42%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           KP  +  +T    GT  GH G V     N K      +++ D T  VW     +      
Sbjct: 40  KPMLRQGDTGDWIGTFLGHKGAVWGATLN-KDATKAATAAADFTAKVWDAVSGD------ 92

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +     H H +  V  + D NY L+G  DK LR++DL
Sbjct: 93  ELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDL 129



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/55 (41%), Positives = 27/55 (49%)
 Frame = +2

Query: 167 WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           +KL + + N G   +   GH   I  V  S DG    SGS D TLRLW    GKT
Sbjct: 245 FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKT 299



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L+  +DK L ++ L + E       K + GH+  I   +  S+    LS   DKT+RLW
Sbjct: 115 LLTGGQDKLLRIYDLNKPEAE----PKEISGHTSGIKKALWCSEDKQILSAD-DKTVRLW 169

Query: 311 DLA 319
           D A
Sbjct: 170 DHA 172


>AY033553-1|AAK57547.1|  627|Homo sapiens F-box protein FBW7
           protein.
          Length = 627

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 330 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 379

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 380 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 412



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 290 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 342

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 343 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 381



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 368 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 419

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 420 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 461



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 457 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 500


>AY008274-1|AAG16640.1|  589|Homo sapiens F-box protein SEL10
           protein.
          Length = 589

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 292 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 341

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 342 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 374



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 252 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 304

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 305 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 343



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 330 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 381

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 382 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 423



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 419 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 462


>AL162070-1|CAB82406.1|  495|Homo sapiens hypothetical protein
           protein.
          Length = 495

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 3/119 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH G V  I   P    +I S S D T++VW++  
Sbjct: 74  SGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPE 133

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFED 349
           +     +  P   L GHS  +  V       N  LS   D  + +W++  G+     +D
Sbjct: 134 NGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDD 192


>AK223449-1|BAD97169.1|  627|Homo sapiens F-box protein FBW7 isoform
           2 variant protein.
          Length = 627

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 330 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 379

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 380 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 412



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 290 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 342

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 343 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 381



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 368 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 419

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 420 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 461



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 457 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 500


>AK001933-1|BAA91986.1|  553|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11071 fis, clone PLACE1004937, moderately
           similar to SEL-10 PROTEIN. ).
          Length = 553

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 256 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 305

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 306 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 338



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 216 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 268

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 269 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 307



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 294 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 345

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 346 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 387



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 383 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 426


>AJ010025-1|CAB38041.1|  350|Homo sapiens unr-interacting protein
           protein.
          Length = 350

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 29/97 (29%), Positives = 41/97 (42%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           KP  +  +T    GT  GH G V     N K      +++ D T  VW     +      
Sbjct: 40  KPMLRQGDTGDWIGTFLGHKGAVWGATLN-KDATKAATAAADFTAKVWDAVSGD------ 92

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +     H H +  V  + D NY L+G  DK LR++DL
Sbjct: 93  ELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDL 129



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/55 (41%), Positives = 27/55 (49%)
 Frame = +2

Query: 167 WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           +KL + + N G   +   GH   I  V  S DG    SGS D TLRLW    GKT
Sbjct: 245 FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKT 299



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L+  +DK L ++ L + E       K + GH+  I   +  S+    LS   DKT+RLW
Sbjct: 115 LLTGGQDKLLRIYDLNKPEAE----PKEISGHTSGIKKALWCSEDKQILSAD-DKTVRLW 169

Query: 311 DLA 319
           D A
Sbjct: 170 DHA 172


>AJ005257-1|CAA06444.1|   86|Homo sapiens protein ( Homo sapiens
           partial mRNA for beta-transducin family protein
           (putative).  ).
          Length = 86

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 31/87 (35%), Positives = 42/87 (48%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   +LRGH   V QIA +     +++S S D TL VW +   +    +P     GH+
Sbjct: 4   TGKYLASLRGHVAAVYQIAWSAD-SRLLVSGSSDSTLKVWDVKAQKLAMDLP-----GHA 57

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLW 310
             +  V  S DG    SG  DK LR+W
Sbjct: 58  DEVYAVDWSPDGQRVASGGKDKCLRIW 84



 Score = 35.1 bits (77), Expect = 0.21
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH   +  +  S+D    +SGS D TL++WD+ A K       H
Sbjct: 11  LRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGH 56


>AF411972-1|AAL06291.1|  627|Homo sapiens archipelago beta form
           protein.
          Length = 627

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 330 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 379

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 380 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 412



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 290 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 342

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 343 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 381



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 368 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 419

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 420 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 461



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 457 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 500


>AF411971-1|AAL06290.1|  707|Homo sapiens archipelago alpha form
           protein.
          Length = 707

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 410 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 459

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 460 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 492



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 370 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 422

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 423 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 461



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 448 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 499

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 500 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 541



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 537 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 580


>AF383178-1|AAK60269.1|  561|Homo sapiens F-box protein FBX30
           protein.
          Length = 561

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 264 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 313

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 314 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 346



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 224 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 276

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 277 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 315



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 302 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 353

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 354 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 395



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 391 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 434


>AF106683-1|AAD43036.1|  421|Homo sapiens WSB-1 protein.
          Length = 421

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 31/101 (30%), Positives = 46/101 (45%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL   L  H   V  +   P    +++S+SRDKTL VW L +D+ N     K L GH 
Sbjct: 159 TGKLLLNLVDHTEVVRDLTLAPDGSLILVSASRDKTLRVWDL-KDDGNM---MKVLRGHQ 214

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +++     S D +        K + LW++      R+ E H
Sbjct: 215 NWVYSCAFSPDSSMLCPVGASKAVFLWNMDKYTMIRKLEGH 255



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 26/91 (28%), Positives = 39/91 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV   A +P    M+      K + +W + +    Y + +K L GH H +    
Sbjct: 210 LRGHQNWVYSCAFSPD-SSMLCPVGASKAVFLWNMDK----YTMIRK-LEGHHHDVVACD 263

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    + S+D  + +WD   G     F
Sbjct: 264 FSPDGALLATASYDTRVYIWDPHNGDILMEF 294


>AB209909-1|BAD93146.1|  501|Homo sapiens coronin, actin binding
           protein, 1C variant protein.
          Length = 501

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 3/119 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH G V  I   P    +I S S D T++VW++  
Sbjct: 80  SGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPE 139

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFED 349
           +     +  P   L GHS  +  V       N  LS   D  + +W++  G+     +D
Sbjct: 140 NGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDD 198


>AB209725-1|BAD92962.1|  624|Homo sapiens F-box protein FBW7 isoform
           2 variant protein.
          Length = 624

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 34/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +2

Query: 50  TLKLRGTLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           T K   TL GH G  W +Q+  N     +I+S S D+TL VW     E  +      LYG
Sbjct: 327 TGKCLRTLVGHTGGVWSSQMRDN-----IIISGSTDRTLKVWNAETGECIH-----TLYG 376

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           H+  +  + L       +SGS D TLR+WD+  G+
Sbjct: 377 HTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQ 409



 Score = 35.9 bits (79), Expect = 0.12
 Identities = 30/101 (29%), Positives = 44/101 (43%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           LK    L+GH+  V  I       + I+S S D TL VW         G   + L GH+ 
Sbjct: 287 LKSPKVLKGHDDHV--ITCLQFCGNRIVSGSDDNTLKVWSAVT-----GKCLRTLVGHTG 339

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +    +    N  +SGS D+TL++W+   G+       HT
Sbjct: 340 GVWSSQMRD--NIIISGSTDRTLKVWNAETGECIHTLYGHT 378



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 29/104 (27%), Positives = 46/104 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           +ET +   TL GH   V  +  + K    ++S SRD TL VW +   +  +      L G
Sbjct: 365 AETGECIHTLYGHTSTVRCMHLHEK---RVVSGSRDATLRVWDIETGQCLHV-----LMG 416

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           H   +  V    DG   +SG++D  +++WD          + HT
Sbjct: 417 HVAAVRCV--QYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT 458



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L GH++ +    L  DG + +SGS D ++R+WD+  G        H
Sbjct: 454 LQGHTNRVYS--LQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGH 497


>AB030656-1|BAA83077.1|  474|Homo sapiens hCRNN4 protein.
          Length = 474

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 32/119 (26%), Positives = 49/119 (41%), Gaps = 3/119 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH G V  I   P    +I S S D T++VW++  
Sbjct: 53  SGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPE 112

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFED 349
           +     +  P   L GHS  +  V       N  LS   D  + +W++  G+     +D
Sbjct: 113 NGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDD 171


>AB024327-1|BAA75544.1|  350|Homo sapiens WD-40 repeat protein
           protein.
          Length = 350

 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 29/97 (29%), Positives = 41/97 (42%)
 Frame = +2

Query: 26  KPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           KP  +  +T    GT  GH G V     N K      +++ D T  VW     +      
Sbjct: 40  KPMLRQGDTGDWIGTFLGHKGAVWGATLN-KDATKAATAAADFTAKVWDAVSGD------ 92

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +     H H +  V  + D NY L+G  DK LR++DL
Sbjct: 93  ELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDL 129



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 23/55 (41%), Positives = 27/55 (49%)
 Frame = +2

Query: 167 WKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           +KL + + N G   +   GH   I  V  S DG    SGS D TLRLW    GKT
Sbjct: 245 FKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKT 299



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +L+  +DK L ++ L + E       K + GH+  I   +  S+    LS   DKT+RLW
Sbjct: 115 LLTGGQDKLLRIYDLNKPEAE----PKEISGHTSGIKKALWCSEDKQILSAD-DKTVRLW 169

Query: 311 DLA 319
           D A
Sbjct: 170 DHA 172


>BC026353-1|AAH26353.1|  677|Homo sapiens WD repeat domain 48
           protein.
          Length = 677

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L G+   +  +A N +   +I+S S +K L VW    D        K L GH+  +  +
Sbjct: 163 SLSGNKDSIYSLAMN-QLGTIIVSGSTEKVLRVW----DPRTCAKLMK-LKGHTDNVKAL 216

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +L+ DG   LSGS D T+RLW L   +    +  H
Sbjct: 217 LLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYRVH 251



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 4/100 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR----DENNYGIPQKRLYGHSHF 235
           TLR H  +V  +A   K  +++ S+  D+ + +W +        +N  +    L G+   
Sbjct: 112 TLRTHKDYVKALAY-AKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDS 170

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           I  + ++  G   +SGS +K LR+WD        + + HT
Sbjct: 171 IYSLAMNQLGTIIVSGSTEKVLRVWDPRTCAKLMKLKGHT 210



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 3/79 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + ++ RD  + +W + + + +  I    +  H+ +++D+VL  +G   +S S D T+++W
Sbjct: 45  LFTAGRDSIIRIWSVNQHKQDPYIAS--MEHHTDWVNDIVLCCNGKTLISASSDTTVKVW 102

Query: 311 DLAAG---KTTRRFEDHTK 358
           +   G    T R  +D+ K
Sbjct: 103 NAHKGFCMSTLRTHKDYVK 121


>BC023662-1|AAH23662.2|  475|Homo sapiens RRP9, small subunit (SSU)
           processome component, homolog (yeast) protein.
          Length = 475

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GHSH 232
           LRGH   +T +   P     I S+++D ++I W +      + IP+ +        GHS 
Sbjct: 142 LRGHQLSITCLVVTPD-DSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSS 200

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  + +SSDG Y  SG   K + +W+  + +    F  H
Sbjct: 201 HVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGH 240



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 22/83 (26%), Positives = 41/83 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   V+ +A   +    + S+S D+++ VW +   EN+Y    + L+GH   ++ +
Sbjct: 236 TFTGHRDAVSGLAFR-RGTHQLYSTSHDRSVKVWNVA--ENSY---VETLFGHQDAVAAL 289

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
              S      +G  D T+R+W +
Sbjct: 290 DALSRECCVTAGGRDGTVRVWKI 312


>BC010048-1|AAH10048.1|  475|Homo sapiens RRP9, small subunit (SSU)
           processome component, homolog (yeast) protein.
          Length = 475

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GHSH 232
           LRGH   +T +   P     I S+++D ++I W +      + IP+ +        GHS 
Sbjct: 142 LRGHQLSITCLVVTPD-DSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSS 200

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  + +SSDG Y  SG   K + +W+  + +    F  H
Sbjct: 201 HVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGH 240



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 22/83 (26%), Positives = 41/83 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   V+ +A   +    + S+S D+++ VW +   EN+Y    + L+GH   ++ +
Sbjct: 236 TFTGHRDAVSGLAFR-RGTHQLYSTSHDRSVKVWNVA--ENSY---VETLFGHQDAVAAL 289

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
              S      +G  D T+R+W +
Sbjct: 290 DALSRECCVTAGGRDGTVRVWKI 312


>BC009879-1|AAH09879.1|  475|Homo sapiens RRP9, small subunit (SSU)
           processome component, homolog (yeast) protein.
          Length = 475

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GHSH 232
           LRGH   +T +   P     I S+++D ++I W +      + IP+ +        GHS 
Sbjct: 142 LRGHQLSITCLVVTPD-DSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSS 200

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  + +SSDG Y  SG   K + +W+  + +    F  H
Sbjct: 201 HVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGH 240



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 22/83 (26%), Positives = 41/83 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   V+ +A   +    + S+S D+++ VW +   EN+Y    + L+GH   ++ +
Sbjct: 236 TFTGHRDAVSGLAFR-RGTHQLYSTSHDRSVKVWNVA--ENSY---VETLFGHQDAVAAL 289

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
              S      +G  D T+R+W +
Sbjct: 290 DALSRECCVTAGGRDGTVRVWKI 312


>BC001113-1|AAH01113.1|  475|Homo sapiens RRP9, small subunit (SSU)
           processome component, homolog (yeast) protein.
          Length = 475

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GHSH 232
           LRGH   +T +   P     I S+++D ++I W +      + IP+ +        GHS 
Sbjct: 142 LRGHQLSITCLVVTPD-DSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSS 200

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  + +SSDG Y  SG   K + +W+  + +    F  H
Sbjct: 201 HVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGH 240



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 22/83 (26%), Positives = 41/83 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   V+ +A   +    + S+S D+++ VW +   EN+Y    + L+GH   ++ +
Sbjct: 236 TFTGHRDAVSGLAFR-RGTHQLYSTSHDRSVKVWNVA--ENSY---VETLFGHQDAVAAL 289

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
              S      +G  D T+R+W +
Sbjct: 290 DALSRECCVTAGGRDGTVRVWKI 312


>AJ001340-1|CAA04687.1|  475|Homo sapiens U3 snoRNP associated 55
           kDa protein protein.
          Length = 475

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY------GHSH 232
           LRGH   +T +   P     I S+++D ++I W +      + IP+ +        GHS 
Sbjct: 142 LRGHQLSITCLVVTPD-DSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSS 200

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  + +SSDG Y  SG   K + +W+  + +    F  H
Sbjct: 201 HVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGH 240



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 22/83 (26%), Positives = 41/83 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   V+ +A   +    + S+S D+++ VW +   EN+Y    + L+GH   ++ +
Sbjct: 236 TFTGHRDAVSGLAFR-RGTHQLYSTSHDRSVKVWNVA--ENSY---VETLFGHQDAVAAL 289

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
              S      +G  D T+R+W +
Sbjct: 290 DALSRECCVTAGGRDGTVRVWKI 312


>AF492460-1|AAN64030.1| 1322|Homo sapiens WD repeat 17 protein.
          Length = 1322

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P    ++ S S D T+ +W  T+D          L GH+  +  ++ +
Sbjct: 564 GHTAKVFHVKWSPLREGILCSGSDDGTVRIWDYTQDACI-----NILNGHTAPVRGLMWN 618

Query: 257 SDGNYAL-SGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  Y L SGSWD T+++WD   G       DH
Sbjct: 619 TEIPYLLISGSWDYTIKVWDTREGTCVDTVYDH 651



 Score = 35.5 bits (78), Expect = 0.16
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V  +  N + P +++S S D T+ VW  TR+    G     +Y H   +  + 
Sbjct: 605 LNGHTAPVRGLMWNTEIPYLLISGSWDYTIKVWD-TRE----GTCVDTVYDHGADVYGLT 659

Query: 251 LSSDGNYAL-SGSWDKTLRLWDLAA 322
                 + + S S D T+RLW L A
Sbjct: 660 CHPSRPFTMASCSRDSTVRLWSLTA 684



 Score = 31.9 bits (69), Expect = 1.9
 Identities = 13/44 (29%), Positives = 21/44 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           KL   +  H   +T I+  P  PD+  S S D  +I+W +   +
Sbjct: 74  KLHAIMSEHKKTITAISWCPHNPDLFASGSTDNLVIIWNVAEQK 117



 Score = 30.7 bits (66), Expect = 4.4
 Identities = 21/93 (22%), Positives = 40/93 (43%), Gaps = 1/93 (1%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   +      P  P+++ ++S D T+ VW +      Y  P     G+   I  +  +
Sbjct: 391 GHVETIFDCKFKPDDPNLLATASFDGTIKVWDINTLTAVYTSP-----GNEGVIYSLSWA 445

Query: 257 SDGNYALSGSWDKT-LRLWDLAAGKTTRRFEDH 352
             G   ++G   +    +W++  GK  +RF +H
Sbjct: 446 PGGLNCIAGGTSRNGAFIWNVQKGKIIQRFNEH 478


>AF468833-1|AAL78650.1|  677|Homo sapiens WD repeat endosomal
           protein protein.
          Length = 677

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L G+   +  +A N +   +I+S S +K L VW    D        K L GH+  +  +
Sbjct: 163 SLSGNKDSIYSLAMN-QLGTIIVSGSTEKVLRVW----DPRTCAKLMK-LKGHTDNVKAL 216

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +L+ DG   LSGS D T+RLW L   +    +  H
Sbjct: 217 LLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYRVH 251



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 4/100 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR----DENNYGIPQKRLYGHSHF 235
           TLR H  +V  +A   K  +++ S+  D+ + +W +        +N  +    L G+   
Sbjct: 112 TLRTHKDYVKALAY-AKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDS 170

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           I  + ++  G   +SGS +K LR+WD        + + HT
Sbjct: 171 IYSLAMNQLGTIIVSGSTEKVLRVWDPRTCAKLMKLKGHT 210



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 3/79 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + ++ RD  + +W + + + +  I    +  H+ +++D+VL  +G   +S S D T+++W
Sbjct: 45  LFTAGRDSIIRIWSVNQHKQDPYIAS--MEHHTDWVNDIVLCCNGKTLISASSDTTVKVW 102

Query: 311 DLAAG---KTTRRFEDHTK 358
           +   G    T R  +D+ K
Sbjct: 103 NAHKGFCMSTLRTHKDYVK 121


>AF332505-1|AAK97355.1|  756|Homo sapiens apoptosis-inhibitor-like
           protein protein.
          Length = 756

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 13/104 (12%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKY--------PDMILSSSRDKTLIVWKLTRD--- 184
           K++  + L   L GH  WV  +   P +        P  +LS+S DKT+I+W    +   
Sbjct: 242 KIAFAVTLETVLAGHENWVNAVHWQPVFYKDGVLQQPVRLLSASMDKTMILWAPDEESGV 301

Query: 185 --ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
             E     P+  + GH   + D+V   +G + ++   D+T RL+
Sbjct: 302 WLEQREWTPEIVISGHFDGVQDLVWDPEGEFIITVGTDQTTRLF 345


>AB040882-1|BAA95973.2|  680|Homo sapiens KIAA1449 protein protein.
          Length = 680

 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L G+   +  +A N +   +I+S S +K L VW    D        K L GH+  +  +
Sbjct: 166 SLSGNKDSIYSLAMN-QLGTIIVSGSTEKVLRVW----DPRTCAKLMK-LKGHTDNVKAL 219

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +L+ DG   LSGS D T+RLW L   +    +  H
Sbjct: 220 LLNRDGTQCLSGSSDGTIRLWSLGQQRCIATYRVH 254



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 4/100 (4%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR----DENNYGIPQKRLYGHSHF 235
           TLR H  +V  +A   K  +++ S+  D+ + +W +        +N  +    L G+   
Sbjct: 115 TLRTHKDYVKALAY-AKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDS 173

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           I  + ++  G   +SGS +K LR+WD        + + HT
Sbjct: 174 IYSLAMNQLGTIIVSGSTEKVLRVWDPRTCAKLMKLKGHT 213



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 3/79 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + ++ RD  + +W + + + +  I    +  H+ +++D+VL  +G   +S S D T+++W
Sbjct: 48  LFTAGRDSIIRIWSVNQHKQDPYIAS--MEHHTDWVNDIVLCCNGKTLISASSDTTVKVW 105

Query: 311 DLAAG---KTTRRFEDHTK 358
           +   G    T R  +D+ K
Sbjct: 106 NAHKGFCMSTLRTHKDYVK 124


>BC126381-1|AAI26382.1|  848|Homo sapiens WD repeat domain 78
           protein.
          Length = 848

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 26/83 (31%), Positives = 40/83 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH G V ++  NP   D+ LS S D  +I+W   + EN    P    Y  +  + DV
Sbjct: 699 TYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIW---QQENVK--PSLSFYPATSVVYDV 753

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             S   +Y  + + +  + +WDL
Sbjct: 754 AWSPKSSYIFAAANENRVEIWDL 776


>BC126379-1|AAI26380.1|  848|Homo sapiens WD repeat domain 78
           protein.
          Length = 848

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 26/83 (31%), Positives = 40/83 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH G V ++  NP   D+ LS S D  +I+W   + EN    P    Y  +  + DV
Sbjct: 699 TYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIW---QQENVK--PSLSFYPATSVVYDV 753

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             S   +Y  + + +  + +WDL
Sbjct: 754 AWSPKSSYIFAAANENRVEIWDL 776


>BC119692-1|AAI19693.1|  407|Homo sapiens WD repeat domain 51A
           protein.
          Length = 407

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +E   L    +GH   VT +  + N K    + S S D  L+VW +      Y     R 
Sbjct: 6   AEDPSLERHFKGHRDAVTCVDFSINTK---QLASGSMDSCLMVWHMKPQSRAY-----RF 57

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
            GH   ++ V  S  G+   SGS DKT+R+W       +  F  HT   ++  FC
Sbjct: 58  TGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFC 112



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +++S DKT+ VW   R +  + + Q     H +++     S DG   +S S DKT++LWD
Sbjct: 119 VTASDDKTVKVWATHRQKFLFSLSQ-----HINWVRCAKFSPDGRLIVSASDDKTVKLWD 173

Query: 314 LAAGKTTRRFEDH 352
            ++ +    + +H
Sbjct: 174 KSSRECVHSYCEH 186



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 23/78 (29%), Positives = 36/78 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   VT +  +P    ++ S SRDKT+ +W       N          H+  +  V   
Sbjct: 59  GHKDAVTCVNFSPS-GHLLASGSRDKTVRIWV-----PNVKGESTVFRAHTATVRSVHFC 112

Query: 257 SDGNYALSGSWDKTLRLW 310
           SDG   ++ S DKT+++W
Sbjct: 113 SDGQSFVTASDDKTVKVW 130


>BC113421-1|AAI13422.1|  514|Homo sapiens transducin (beta)-like
           1X-linked receptor 1 protein.
          Length = 514

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 35/72 (48%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           NP    M+ S+S D T+ +W + R     GI    L  H   +  V  S DG Y  SGS+
Sbjct: 408 NPNANLMLASASFDSTVRLWDVDR-----GICIHTLTKHQEPVYSVAFSPDGRYLASGSF 462

Query: 290 DKTLRLWDLAAG 325
           DK + +W+   G
Sbjct: 463 DKCVHIWNTQTG 474



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 29/99 (29%), Positives = 46/99 (46%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G  +++   HS   
Sbjct: 258 LASTLGQHKGPIFALKWNKK-GNFILSAGVDKTTIIW-----DAHTGEAKQQFPFHSAPA 311

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DV   S+  +A S S D  + +  L   +  + F+ HT
Sbjct: 312 LDVDWQSNNTFA-SCSTDMCIHVCKLGQDRPIKTFQGHT 349



 Score = 33.5 bits (73), Expect = 0.63
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S S D  + V KL +D      P K   GH++ ++ +     GN   S S D TL++W +
Sbjct: 324 SCSTDMCIHVCKLGQDR-----PIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSM 378

Query: 317 AAGKTTRRFEDHTK 358
                    + H K
Sbjct: 379 KQDNCVHDLQAHNK 392


>BC110877-1|AAI10878.1|  359|Homo sapiens WDR51A protein protein.
          Length = 359

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +E   L    +GH   VT +  + N K    + S S D  L+VW +      Y     R 
Sbjct: 6   AEDPSLERHFKGHRDAVTCVDFSINTK---QLASGSMDSCLMVWHMKPQSRAY-----RF 57

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
            GH   ++ V  S  G+   SGS DKT+R+W       +  F  HT   ++  FC
Sbjct: 58  TGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFC 112



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +++S DKT+ VW   R +  + + Q     H +++     S DG   +S S DKT++LWD
Sbjct: 119 VTASDDKTVKVWATHRQKFLFSLSQ-----HINWVRCAKFSPDGRLIVSASDDKTVKLWD 173

Query: 314 LAAGKTTRRFEDH 352
            ++ +    + +H
Sbjct: 174 KSSRECVHSYCEH 186



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 23/78 (29%), Positives = 36/78 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   VT +  +P    ++ S SRDKT+ +W       N          H+  +  V   
Sbjct: 59  GHKDAVTCVNFSPS-GHLLASGSRDKTVRIWV-----PNVKGESTVFRAHTATVRSVHFC 112

Query: 257 SDGNYALSGSWDKTLRLW 310
           SDG   ++ S DKT+++W
Sbjct: 113 SDGQSFVTASDDKTVKVW 130


>AL592161-2|CAH72705.1|  848|Homo sapiens WD repeat domain 78
           protein.
          Length = 848

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 26/83 (31%), Positives = 40/83 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH G V ++  NP   D+ LS S D  +I+W   + EN    P    Y  +  + DV
Sbjct: 699 TYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIW---QQENVK--PSLSFYPATSVVYDV 753

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             S   +Y  + + +  + +WDL
Sbjct: 754 AWSPKSSYIFAAANENRVEIWDL 776


>AL354978-2|CAH71842.1|  848|Homo sapiens WD repeat domain 78
           protein.
          Length = 848

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 26/83 (31%), Positives = 40/83 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH G V ++  NP   D+ LS S D  +I+W   + EN    P    Y  +  + DV
Sbjct: 699 TYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIW---QQENVK--PSLSFYPATSVVYDV 753

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             S   +Y  + + +  + +WDL
Sbjct: 754 AWSPKSSYIFAAANENRVEIWDL 776


>AL139216-3|CAI18872.1|  848|Homo sapiens WD repeat domain 78
           protein.
          Length = 848

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 26/83 (31%), Positives = 40/83 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH G V ++  NP   D+ LS S D  +I+W   + EN    P    Y  +  + DV
Sbjct: 699 TYRGHKGPVYKVTWNPFCHDVFLSCSADWGVIIW---QQENVK--PSLSFYPATSVVYDV 753

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             S   +Y  + + +  + +WDL
Sbjct: 754 AWSPKSSYIFAAANENRVEIWDL 776


>AK223073-1|BAD96793.1|  474|Homo sapiens coronin, actin binding
           protein, 1C variant protein.
          Length = 474

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 32/119 (26%), Positives = 48/119 (40%), Gaps = 3/119 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH G V  I   P     I S S D T++VW++  
Sbjct: 53  SGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQAIASGSEDCTVMVWQIPE 112

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFED 349
           +     +  P   L GHS  +  V       N  LS   D  + +W++  G+     +D
Sbjct: 113 NGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDD 171


>AK075289-1|BAC11525.1|  407|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90808 fis, clone Y79AA1000777, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1. ).
          Length = 407

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 2/115 (1%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +E   L    +GH   VT +  + N K    + S S D  L+VW +      Y     R 
Sbjct: 6   AEDPSLERHFKGHRDAVTCVDFSINTK---QLASGSMDSCLMVWHMKPQSRAY-----RF 57

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
            GH   ++ V  S  G+   SGS DKT+R+W       +  F  HT   ++  FC
Sbjct: 58  TGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFC 112



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +++S DKT+ VW   R +  + + Q     H +++     S DG   +S S DKT++LWD
Sbjct: 119 VTASDDKTVKVWATHRQKFLFSLSQ-----HINWVRCAKFSPDGRLIVSASDDKTVKLWD 173

Query: 314 LAAGKTTRRFEDH 352
            ++ +    + +H
Sbjct: 174 KSSRECVHSYCEH 186



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 23/78 (29%), Positives = 36/78 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   VT +  +P    ++ S SRDKT+ +W       N          H+  +  V   
Sbjct: 59  GHKDAVTCVNFSPS-GHLLASGSRDKTVRIWV-----PNVKGESTVFRAHTATVRSVHFC 112

Query: 257 SDGNYALSGSWDKTLRLW 310
           SDG   ++ S DKT+++W
Sbjct: 113 SDGQSFVTASDDKTVKVW 130


>AK022956-1|BAB14331.1|  514|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12894 fis, clone NT2RP2004170, moderately
           similar to Homo sapiens mRNA for transducin (beta) like
           1 protein. ).
          Length = 514

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 35/72 (48%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           NP    M+ S+S D T+ +W + R     GI    L  H   +  V  S DG Y  SGS+
Sbjct: 408 NPNANLMLASASFDSTVRLWDVDR-----GICIHTLTKHQEPVYSVAFSPDGRYLASGSF 462

Query: 290 DKTLRLWDLAAG 325
           DK + +W+   G
Sbjct: 463 DKCVHIWNTQTG 474



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 29/99 (29%), Positives = 46/99 (46%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G  +++   HS   
Sbjct: 258 LASTLGQHKGPIFALKWNKK-GNFILSAGVDKTTIIW-----DAHTGEAKQQFPFHSAPA 311

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DV   S+  +A S S D  + +  L   +  + F+ HT
Sbjct: 312 LDVDWQSNNTFA-SCSTDMCIHVCKLGQDRPIKTFQGHT 349



 Score = 33.5 bits (73), Expect = 0.63
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S S D  + V KL +D      P K   GH++ ++ +     GN   S S D TL++W +
Sbjct: 324 SCSTDMCIHVCKLGQDR-----PIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSM 378

Query: 317 AAGKTTRRFEDHTK 358
                    + H K
Sbjct: 379 KQDNCVHDLQAHNK 392


>AF314544-1|AAK00301.1|  514|Homo sapiens nuclear receptor
           co-repressor/HDAC3 complex subunit TBLR1 protein.
          Length = 514

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 35/72 (48%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           NP    M+ S+S D T+ +W + R     GI    L  H   +  V  S DG Y  SGS+
Sbjct: 408 NPNANLMLASASFDSTVRLWDVDR-----GICIHTLTKHQEPVYSVAFSPDGRYLASGSF 462

Query: 290 DKTLRLWDLAAG 325
           DK + +W+   G
Sbjct: 463 DKCVHIWNTQTG 474



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 29/99 (29%), Positives = 46/99 (46%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G  +++   HS   
Sbjct: 258 LASTLGQHKGPIFALKWNKK-GNFILSAGVDKTTIIW-----DAHTGEAKQQFPFHSAPA 311

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DV   S+  +A S S D  + +  L   +  + F+ HT
Sbjct: 312 LDVDWQSNNTFA-SCSTDMCIHVCKLGQDRPIKTFQGHT 349



 Score = 33.5 bits (73), Expect = 0.63
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S S D  + V KL +D      P K   GH++ ++ +     GN   S S D TL++W +
Sbjct: 324 SCSTDMCIHVCKLGQDR-----PIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSM 378

Query: 317 AAGKTTRRFEDHTK 358
                    + H K
Sbjct: 379 KQDNCVHDLQAHNK 392


>AF268193-1|AAG44736.1|  514|Homo sapiens IRA1 protein.
          Length = 514

 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 35/72 (48%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           NP    M+ S+S D T+ +W + R     GI    L  H   +  V  S DG Y  SGS+
Sbjct: 408 NPNANLMLASASFDSTVRLWDVDR-----GICIHTLTKHQEPVYSVAFSPDGRYLASGSF 462

Query: 290 DKTLRLWDLAAG 325
           DK + +W+   G
Sbjct: 463 DKCVHIWNTQTG 474



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 29/99 (29%), Positives = 46/99 (46%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G  +++   HS   
Sbjct: 258 LASTLGQHKGPIFALKWNKK-GNFILSAGVDKTTIIW-----DAHTGEAKQQFPFHSAPA 311

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DV   S+  +A S S D  + +  L   +  + F+ HT
Sbjct: 312 LDVDWQSNNTFA-SCSTDMCIHVCKLGQDRPIKTFQGHT 349



 Score = 34.3 bits (75), Expect = 0.36
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S S D  + V KL +D      P K   GH++ ++ +     GN   S S D TL++W +
Sbjct: 324 SCSTDMCIHVCKLGQDR-----PIKTFQGHTNEVNAIKWDPTGNLLASCSDDMTLKIWSM 378

Query: 317 AAGKTTRRFEDHTK 358
                    + H K
Sbjct: 379 KQDNCVHDLQQHNK 392


>X89109-1|CAA61482.1|  461|Homo sapiens coronin homologue protein.
          Length = 461

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH   V  IA  P   ++I S S D T++VW++  
Sbjct: 54  SGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPD 113

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAG 325
                 +  P   L GH+  +  V   +   N  LS   D  + +WD+  G
Sbjct: 114 GGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTG 164


>U34690-1|AAA77058.1|  461|Homo sapiens coronin-like protein
           protein.
          Length = 461

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH   V  IA  P   ++I S S D T++VW++  
Sbjct: 54  SGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPD 113

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAG 325
                 +  P   L GH+  +  V   +   N  LS   D  + +WD+  G
Sbjct: 114 GGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTG 164


>D44497-1|BAA07940.1|  461|Homo sapiens human p57 protein.
          Length = 461

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH   V  IA  P   ++I S S D T++VW++  
Sbjct: 54  SGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPD 113

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAG 325
                 +  P   L GH+  +  V   +   N  LS   D  + +WD+  G
Sbjct: 114 GGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTG 164


>BC126387-1|AAI26388.1|  461|Homo sapiens coronin, actin binding
           protein, 1A protein.
          Length = 461

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH   V  IA  P   ++I S S D T++VW++  
Sbjct: 54  SGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPD 113

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAG 325
                 +  P   L GH+  +  V   +   N  LS   D  + +WD+  G
Sbjct: 114 GGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTG 164


>BC126385-1|AAI26386.1|  461|Homo sapiens coronin, actin binding
           protein, 1A protein.
          Length = 461

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH   V  IA  P   ++I S S D T++VW++  
Sbjct: 54  SGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPD 113

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAG 325
                 +  P   L GH+  +  V   +   N  LS   D  + +WD+  G
Sbjct: 114 GGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTG 164


>BC119693-1|AAI19694.1|  441|Homo sapiens WDR51A protein protein.
          Length = 441

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 2/114 (1%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           E   L    +GH   VT +  + N K    + S S D  L+VW +      Y     R  
Sbjct: 41  EDPSLERHFKGHRDAVTCVDFSINTK---QLASGSMDSCLMVWHMKPQSRAY-----RFT 92

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
           GH   ++ V  S  G+   SGS DKT+R+W       +  F  HT   ++  FC
Sbjct: 93  GHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFC 146



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +++S DKT+ VW   R +  + + Q     H +++     S DG   +S S DKT++LWD
Sbjct: 153 VTASDDKTVKVWATHRQKFLFSLSQ-----HINWVRCAKFSPDGRLIVSASDDKTVKLWD 207

Query: 314 LAAGKTTRRFEDH 352
            ++ +    + +H
Sbjct: 208 KSSRECVHSYCEH 220



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 23/78 (29%), Positives = 36/78 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   VT +  +P    ++ S SRDKT+ +W       N          H+  +  V   
Sbjct: 93  GHKDAVTCVNFSPS-GHLLASGSRDKTVRIWV-----PNVKGESTVFRAHTATVRSVHFC 146

Query: 257 SDGNYALSGSWDKTLRLW 310
           SDG   ++ S DKT+++W
Sbjct: 147 SDGQSFVTASDDKTVKVW 164


>BC110374-1|AAI10375.1|  461|Homo sapiens coronin, actin binding
           protein, 1A protein.
          Length = 461

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH   V  IA  P   ++I S S D T++VW++  
Sbjct: 54  SGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPD 113

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAG 325
                 +  P   L GH+  +  V   +   N  LS   D  + +WD+  G
Sbjct: 114 GGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTG 164


>AK222576-1|BAD96296.1|  421|Homo sapiens WD SOCS-box protein 1
           isoform 1 variant protein.
          Length = 421

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/99 (31%), Positives = 46/99 (46%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T KL   L  H   V  +   P    +++S+SRDKTL VW L +D+ N     K L GH 
Sbjct: 159 TGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDL-KDDGNM---MKVLRGHQ 214

Query: 230 HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +++     S D +   S    K + LW++      R+ E
Sbjct: 215 NWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLE 253



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 26/91 (28%), Positives = 39/91 (42%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LRGH  WV   A +P    M+ S    K + +W + +    Y + +K L G  H +    
Sbjct: 210 LRGHQNWVYSCAFSPD-SSMLCSVGASKAVFLWNMDK----YTMIRK-LEGRHHDVVACD 263

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
            S DG    + S+D  + +WD   G     F
Sbjct: 264 FSPDGALLATASYDTRVYIWDPHNGDILMEF 294


>AF495470-1|AAM18516.1|  461|Homo sapiens tryptophane
           aspartate-containing coat protein protein.
          Length = 461

 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P  K     K   T+ GH   V  IA  P   ++I S S D T++VW++  
Sbjct: 54  SGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPD 113

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAG 325
                 +  P   L GH+  +  V   +   N  LS   D  + +WD+  G
Sbjct: 114 GGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTG 164


>U24105-1|AAB70879.1| 1224|Homo sapiens coatomer protein protein.
          Length = 1224

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   A +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 197 VKHVLEGHDRGVNWAAFHPTMP-LIVSGADDRQVKIWRMN-ESKAWEVDTCR--GHYNNV 252

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF-EDHTK 358
           S  V        LS S DK++R+WD++     + F  DH +
Sbjct: 253 SCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDR 293



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 25/84 (29%), Positives = 44/84 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++     + +YP  ILS+S D+T+ VW   +      +    L GH+H++   
Sbjct: 88  TLLGHLDYIRTTFFHHEYP-WILSASDDQTIRVWNW-QSRTCVCV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDLVVSASLDQTVRVWDIS 165


>BC038447-1|AAH38447.1| 1233|Homo sapiens COPA protein protein.
          Length = 1233

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   A +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 197 VKHVLEGHDRGVNWAAFHPTMP-LIVSGADDRQVKIWRMN-ESKAWEVDTCR--GHYNNV 252

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF-EDHTK 358
           S  V        LS S DK++R+WD++     + F  DH +
Sbjct: 253 SCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDR 293



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 25/84 (29%), Positives = 44/84 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++     + +YP  ILS+S D+T+ VW   +      +    L GH+H++   
Sbjct: 88  TLLGHLDYIRTTFFHHEYP-WILSASDDQTIRVWNW-QSRTCVCV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDLVVSASLDQTVRVWDIS 165


>BC007417-1|AAH07417.2|  396|Homo sapiens WDR51A protein protein.
          Length = 396

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 32/105 (30%), Positives = 46/105 (43%), Gaps = 2/105 (1%)
 Frame = +2

Query: 74  RGHNGWVTQI--ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +GH   VT +  + N K    + S S D  L+VW +      Y     R  GH   ++ V
Sbjct: 5   KGHRDAVTCVDFSINTK---QLASGSMDSCLMVWHMKPQSRAY-----RFTGHKDAVTCV 56

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV*QNS*FC 382
             S  G+   SGS DKT+R+W       +  F  HT   ++  FC
Sbjct: 57  NFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFC 101



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +++S DKT+ VW   R +  + + Q     H +++     S DG   +S S DKT++LWD
Sbjct: 108 VTASDDKTVKVWATHRQKFLFSLSQ-----HINWVRCAKFSPDGRLIVSASDDKTVKLWD 162

Query: 314 LAAGKTTRRFEDH 352
            ++ +    + +H
Sbjct: 163 KSSRECVHSYCEH 175



 Score = 33.9 bits (74), Expect = 0.47
 Identities = 23/78 (29%), Positives = 36/78 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   VT +  +P    ++ S SRDKT+ +W       N          H+  +  V   
Sbjct: 48  GHKDAVTCVNFSPS-GHLLASGSRDKTVRIWV-----PNVKGESTVFRAHTATVRSVHFC 101

Query: 257 SDGNYALSGSWDKTLRLW 310
           SDG   ++ S DKT+++W
Sbjct: 102 SDGQSFVTASDDKTVKVW 119


>AL513282-3|CAI12455.1| 1233|Homo sapiens coatomer protein complex,
           subunit alpha protein.
          Length = 1233

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   A +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 197 VKHVLEGHDRGVNWAAFHPTMP-LIVSGADDRQVKIWRMN-ESKAWEVDTCR--GHYNNV 252

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF-EDHTK 358
           S  V        LS S DK++R+WD++     + F  DH +
Sbjct: 253 SCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDR 293



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 25/84 (29%), Positives = 44/84 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++     + +YP  ILS+S D+T+ VW   +      +    L GH+H++   
Sbjct: 88  TLLGHLDYIRTTFFHHEYP-WILSASDDQTIRVWNW-QSRTCVCV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDLVVSASLDQTVRVWDIS 165


>AL513282-2|CAI12454.1| 1224|Homo sapiens coatomer protein complex,
           subunit alpha protein.
          Length = 1224

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   A +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 197 VKHVLEGHDRGVNWAAFHPTMP-LIVSGADDRQVKIWRMN-ESKAWEVDTCR--GHYNNV 252

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF-EDHTK 358
           S  V        LS S DK++R+WD++     + F  DH +
Sbjct: 253 SCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDR 293



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 25/84 (29%), Positives = 44/84 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++     + +YP  ILS+S D+T+ VW   +      +    L GH+H++   
Sbjct: 88  TLLGHLDYIRTTFFHHEYP-WILSASDDQTIRVWNW-QSRTCVCV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDLVVSASLDQTVRVWDIS 165


>AL445230-2|CAI15004.1| 1233|Homo sapiens coatomer protein complex,
           subunit alpha protein.
          Length = 1233

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   A +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 197 VKHVLEGHDRGVNWAAFHPTMP-LIVSGADDRQVKIWRMN-ESKAWEVDTCR--GHYNNV 252

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF-EDHTK 358
           S  V        LS S DK++R+WD++     + F  DH +
Sbjct: 253 SCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDR 293



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 25/84 (29%), Positives = 44/84 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++     + +YP  ILS+S D+T+ VW   +      +    L GH+H++   
Sbjct: 88  TLLGHLDYIRTTFFHHEYP-WILSASDDQTIRVWNW-QSRTCVCV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDLVVSASLDQTVRVWDIS 165


>AL445230-1|CAI15005.1| 1224|Homo sapiens coatomer protein complex,
           subunit alpha protein.
          Length = 1224

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   A +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 197 VKHVLEGHDRGVNWAAFHPTMP-LIVSGADDRQVKIWRMN-ESKAWEVDTCR--GHYNNV 252

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF-EDHTK 358
           S  V        LS S DK++R+WD++     + F  DH +
Sbjct: 253 SCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDR 293



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 25/84 (29%), Positives = 44/84 (52%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL GH  ++     + +YP  ILS+S D+T+ VW   +      +    L GH+H++   
Sbjct: 88  TLLGHLDYIRTTFFHHEYP-WILSASDDQTIRVWNW-QSRTCVCV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDLVVSASLDQTVRVWDIS 165


>BX538087-1|CAD98010.1|  913|Homo sapiens hypothetical protein
           protein.
          Length = 913

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>BX537578-1|CAD97788.1|  913|Homo sapiens hypothetical protein
           protein.
          Length = 913

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>BC028697-1|AAH28697.3|  913|Homo sapiens WD repeat domain 44
           protein.
          Length = 913

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>BC028364-1|AAH28364.1| 1061|Homo sapiens FBXW10 protein protein.
          Length = 1061

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+  +  + L  + N+ LSGS+D ++R WDL +G  TR F  H
Sbjct: 480 GHAGSVRALFLCEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGH 523


>BC013997-1|AAH13997.1|  353|Homo sapiens guanine nucleotide binding
           protein (G protein), beta 5 protein.
          Length = 353

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ +   D T+ VW + +     G     L+GH + +S + +S DG    SGSWD TLR+
Sbjct: 297 LLFAGYNDYTINVWDVLK-----GSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351

Query: 308 W 310
           W
Sbjct: 352 W 352



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           IL++S D T  +W +   E+   +     +G      D+  S  GN  +SG  DK   +W
Sbjct: 168 ILTASGDGTCALWDV---ESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVW 224

Query: 311 DLAAGKTTRRFEDH 352
           D+ +G+  + FE H
Sbjct: 225 DMRSGQCVQAFETH 238


>AY729024-1|AAU43731.1| 1052|Homo sapiens ubiquitin ligase
           specificity factor protein.
          Length = 1052

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+  +  + L  + N+ LSGS+D ++R WDL +G  TR F  H
Sbjct: 451 GHAGSVRALFLCEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGH 494


>AL834210-1|CAD38894.1|  805|Homo sapiens hypothetical protein
           protein.
          Length = 805

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 503 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 554

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 555 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 607


>AL391830-2|CAI41512.1|  913|Homo sapiens WD repeat domain 44
           protein.
          Length = 913

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>AL391830-1|CAI41513.1|  905|Homo sapiens WD repeat domain 44
           protein.
          Length = 905

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>AL391803-3|CAI41482.1|  913|Homo sapiens WD repeat domain 44
           protein.
          Length = 913

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>AL391803-2|CAI41483.1|  905|Homo sapiens WD repeat domain 44
           protein.
          Length = 905

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>AL391803-1|CAI41481.1|  805|Homo sapiens WD repeat domain 44
           protein.
          Length = 805

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 503 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 554

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 555 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 607


>AL391474-2|CAI41402.1|  913|Homo sapiens WD repeat domain 44
           protein.
          Length = 913

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>AL391474-1|CAI41403.1|  905|Homo sapiens WD repeat domain 44
           protein.
          Length = 905

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 604 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 655

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 656 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 708


>AK127556-1|BAC87033.1|  429|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45649 fis, clone CTONG2009570, highly  similar
           to Bos taurus rab11 binding protein. ).
          Length = 429

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 131 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 182

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 183 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 235


>AK092077-1|BAC03799.1|  616|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34758 fis, clone NT2NE2001793, highly similar to
           Bos taurus rab11 binding protein mRNA. ).
          Length = 616

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GH   +  ++ +  Y   +LSSS DKT+ +W ++R E          + H  F++ +  
Sbjct: 314 KGHTADLLDLSWSKNY--FLLSSSMDKTVRLWHISRRECLC------CFQHIDFVTAIAF 365

Query: 254 SS-DGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC*GVNADYAL 409
              D  Y LSGS D  LRLW++   K       +  TK+   + FC   N  YA+
Sbjct: 366 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC--QNGKYAV 418


>AF501885-1|AAM15921.1|  353|Homo sapiens guanine nucleotide binding
           protein beta 5 protein.
          Length = 353

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ +   D T+ VW + +     G     L+GH + +S + +S DG    SGSWD TLR+
Sbjct: 297 LLFAGYNDYTINVWDVLK-----GSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351

Query: 308 W 310
           W
Sbjct: 352 W 352



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           IL++S D T  +W +   E+   +     +G      D+  S  GN  +SG  DK   +W
Sbjct: 168 ILTASGDGTCALWDV---ESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVW 224

Query: 311 DLAAGKTTRRFEDH 352
           D+ +G+  + FE H
Sbjct: 225 DMRSGQCVQAFETH 238


>AF300650-1|AAG18444.1|  395|Homo sapiens guanine nucleotide binding
           protein beta subunit 5L protein.
          Length = 395

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ +   D T+ VW + +     G     L+GH + +S + +S DG    SGSWD TLR+
Sbjct: 339 LLFAGYNDYTINVWDVLK-----GSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 393

Query: 308 W 310
           W
Sbjct: 394 W 394



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           IL++S D T  +W +   E+   +     +G      D+  S  GN  +SG  DK   +W
Sbjct: 210 ILTASGDGTCALWDV---ESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVW 266

Query: 311 DLAAGKTTRRFEDH 352
           D+ +G+  + FE H
Sbjct: 267 DMRSGQCVQAFETH 280


>AF017656-1|AAC63826.1|  353|Homo sapiens G protein beta 5 subunit
           protein.
          Length = 353

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++ +   D T+ VW + +     G     L+GH + +S + +S DG    SGSWD TLR+
Sbjct: 297 LLFAGYNDYTINVWDVLK-----GSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351

Query: 308 W 310
           W
Sbjct: 352 W 352



 Score = 39.1 bits (87), Expect = 0.013
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           IL++S D T  +W +   E+   +     +G      D+  S  GN  +SG  DK   +W
Sbjct: 168 ILTASGDGTCALWDV---ESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVW 224

Query: 311 DLAAGKTTRRFEDH 352
           D+ +G+  + FE H
Sbjct: 225 DMRSGQCVQAFETH 238


>AB209899-1|BAD93136.1|  967|Homo sapiens Hypothetical protein
           DKFZp434O1826 variant protein.
          Length = 967

 Score = 42.3 bits (95), Expect = 0.001
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+  +  + L  + N+ LSGS+D ++R WDL +G  TR F  H
Sbjct: 775 GHAGSVRALFLCEEENFLLSGSYDLSIRYWDLKSGVCTRIFGGH 818


>U82756-1|AAC02261.1|  520|Homo sapiens WD splicing factor Hprp4p
           protein.
          Length = 520

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 442 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 496

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 497 DISSDGQLIATCSYDRTFKLW 517



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 31/103 (30%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN    Q+ + PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 266 TLRGHNTKKEQLHSIPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 320

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 321 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 363



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 317 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 370

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 371 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 406


>CR457105-1|CAG33386.1|  521|Homo sapiens PRPF4 protein.
          Length = 521

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 267 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 321

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 322 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 364



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 443 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 497

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 498 DISSDGQLIATCSYDRTFKLW 518



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 318 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 371

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 372 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 407


>BC117291-1|AAI17292.1|  925|Homo sapiens coronin 7 protein.
          Length = 925

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 3/90 (3%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRD--ENNYGIPQKRLYGHSHFISDVVLSS-D 262
           VT +A +P  P  +  +  D  + +W++  +  E     P+  L GH+  I  +      
Sbjct: 547 VTDLAWDPFDPHRLAVAGEDARIRLWRVPAEGLEEVLTTPETVLTGHTEKICSLRFHPLA 606

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            N   S S+D T+R+WDL AG    + + H
Sbjct: 607 ANVLASSSYDLTVRIWDLQAGADRLKLQGH 636



 Score = 33.1 bits (72), Expect = 0.83
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 1/100 (1%)
 Frame = +2

Query: 29  PFSKMSETLKLRGT-LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           P   + E L    T L GH   +  +  +P   +++ SSS D T+ +W L       G  
Sbjct: 575 PAEGLEEVLTTPETVLTGHTEKICSLRFHPLAANVLASSSYDLTVRIWDL-----QAGAD 629

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           + +L GH   I  +  S DG    +   D  +R++   +G
Sbjct: 630 RLKLQGHQDQIFSLAWSPDGQQLATVCKDGRVRVYRPRSG 669


>BC117289-1|AAI17290.1|  925|Homo sapiens coronin 7 protein.
          Length = 925

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 3/90 (3%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRD--ENNYGIPQKRLYGHSHFISDVVLSS-D 262
           VT +A +P  P  +  +  D  + +W++  +  E     P+  L GH+  I  +      
Sbjct: 547 VTDLAWDPFDPHRLAVAGEDARIRLWRVPAEGLEEVLTTPETVLTGHTEKICSLRFHPLA 606

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            N   S S+D T+R+WDL AG    + + H
Sbjct: 607 ANVLASSSYDLTVRIWDLQAGADRLKLQGH 636



 Score = 33.1 bits (72), Expect = 0.83
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 1/100 (1%)
 Frame = +2

Query: 29  PFSKMSETLKLRGT-LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           P   + E L    T L GH   +  +  +P   +++ SSS D T+ +W L       G  
Sbjct: 575 PAEGLEEVLTTPETVLTGHTEKICSLRFHPLAANVLASSSYDLTVRIWDL-----QAGAD 629

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           + +L GH   I  +  S DG    +   D  +R++   +G
Sbjct: 630 RLKLQGHQDQIFSLAWSPDGQQLATVCKDGRVRVYRPRSG 669


>BC037168-1|AAH37168.1|  502|Homo sapiens WDR48 protein protein.
          Length = 502

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 26/75 (34%), Positives = 37/75 (49%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           +I+S S +K L VW    D        K L GH+  +  ++L+ DG   LSGS D T+RL
Sbjct: 7   IIVSGSTEKVLRVW----DPRTCAKLMK-LKGHTDNVKALLLNRDGTQCLSGSSDGTIRL 61

Query: 308 WDLAAGKTTRRFEDH 352
           W L   +    +  H
Sbjct: 62  WSLGQQRCIATYRVH 76


>BC007424-1|AAH07424.1|  521|Homo sapiens PRP4 pre-mRNA processing
           factor 4 homolog (yeast) protein.
          Length = 521

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 267 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 321

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 322 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 364



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 443 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 497

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 498 DISSDGQLIATCSYDRTFKLW 518



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 318 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 371

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 372 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 407


>BC006449-1|AAH06449.1|  489|Homo sapiens coronin, actin binding
           protein, 1B protein.
          Length = 489

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P SK     K   T+ GH G V  I   P   ++I S S D T++VW++  
Sbjct: 55  SGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPE 114

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +     +  P   L GH+  +  +       N  LS   D  + +W++   +   R +
Sbjct: 115 NGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLD 172


>BC001588-1|AAH01588.1|  522|Homo sapiens PRP4 pre-mRNA processing
           factor 4 homolog (yeast) protein.
          Length = 522

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 268 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 322

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 323 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 365



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 444 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 498

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 499 DISSDGQLIATCSYDRTFKLW 519



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 319 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 372

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 373 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 408


>AY572489-1|AAS78572.1|  521|Homo sapiens 60 kDa U4/U6
           snRNP-specific spliceosomal protein protein.
          Length = 521

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 267 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 321

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 322 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 364



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 443 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 497

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 498 DISSDGQLIATCSYDRTFKLW 518



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 318 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 371

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 372 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 407


>AL449305-8|CAI10969.1|  521|Homo sapiens PRP4 pre-mRNA processing
           factor 4 homolog (yeast) protein.
          Length = 521

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 267 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 321

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 322 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 364



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 443 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 497

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 498 DISSDGQLIATCSYDRTFKLW 518



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 318 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 371

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 372 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 407


>AL449305-7|CAI10968.1|  522|Homo sapiens PRP4 pre-mRNA processing
           factor 4 homolog (yeast) protein.
          Length = 522

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 268 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 322

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 323 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 365



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 444 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 498

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 499 DISSDGQLIATCSYDRTFKLW 519



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 319 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 372

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 373 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 408


>AK025674-1|BAB15211.1|  925|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22021 fis, clone HEP08253. ).
          Length = 925

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 3/90 (3%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRD--ENNYGIPQKRLYGHSHFISDVVLSS-D 262
           VT +A +P  P  +  +  D  + +W++  +  E     P+  L GH+  I  +      
Sbjct: 547 VTDLAWDPFDPHRLAVAGEDARIRLWRVPAEGLEEVLTTPETVLTGHTEKICSLRFHPLA 606

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            N   S S+D T+R+WDL AG    + + H
Sbjct: 607 ANVLASSSYDLTVRIWDLQAGADRLKLQGH 636



 Score = 33.1 bits (72), Expect = 0.83
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 1/100 (1%)
 Frame = +2

Query: 29  PFSKMSETLKLRGT-LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           P   + E L    T L GH   +  +  +P   +++ SSS D T+ +W L       G  
Sbjct: 575 PAEGLEEVLTTPETVLTGHTEKICSLRFHPLAANVLASSSYDLTVRIWDL-----QAGAD 629

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           + +L GH   I  +  S DG    +   D  +R++   +G
Sbjct: 630 RLKLQGHQDQIFSLAWSPDGQQLATVCKDGRVRVYRPRSG 669


>AF016369-1|AAC51925.1|  522|Homo sapiens U4/U6 small nuclear
           ribonucleoprotein hPrp4 protein.
          Length = 522

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 268 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 322

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 323 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 365



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 444 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 498

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 499 DISSDGQLIATCSYDRTFKLW 519



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 319 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 372

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 373 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 408


>AF001687-1|AAB87640.1|  521|Homo sapiens U4/U6 snRNP 60 kDa protein
           protein.
          Length = 521

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 267 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 321

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 322 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 364



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 24/83 (28%), Positives = 40/83 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 443 TIPPHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 497

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
            +SSDG    + S+D+T +LW L
Sbjct: 498 DISSDGQLIATYSYDRTFKLWML 520



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 27/96 (28%), Positives = 45/96 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 318 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 371

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     EDH K
Sbjct: 372 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEDHLK 407


>AB209797-1|BAD93034.1|  537|Homo sapiens PRPF4 protein variant
           protein.
          Length = 537

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 7/103 (6%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYP------DMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           TLRGHN  V  I  +PK        D+ L+S + D ++ +W L  DE     P   + GH
Sbjct: 283 TLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDE-----PVADIEGH 337

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  ++ V+    G +  +  +D++ RLWDL A +     E H+
Sbjct: 338 TVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHS 380



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   VT +   P + + +L+ + D T  +W      +    P K L GH   +  +
Sbjct: 459 TIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWT-----HPGWSPLKTLAGHEGKVMGL 513

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +SSDG    + S+D+T +LW
Sbjct: 514 DISSDGQLIATCSYDRTFKLW 534



 Score = 37.9 bits (84), Expect = 0.029
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V ++  +P     + ++  D++  +W L   E    + Q+   GHS  + D+ 
Sbjct: 334 IEGHTVRVARVMWHPS-GRFLGTTCYDRSWRLWDLEAQEEI--LHQE---GHSMGVYDIA 387

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              DG+ A +G  D   R+WDL  G+     E H K
Sbjct: 388 FHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLK 423


>AB209579-1|BAD92816.1|  287|Homo sapiens coronin, actin binding
           protein, 1B variant protein.
          Length = 287

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           + G + L  P SK     K   T+ GH G V  I   P   ++I S S D T++VW++  
Sbjct: 82  SGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPE 141

Query: 182 DENNYGI--PQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +     +  P   L GH+  +  +       N  LS   D  + +W++   +   R +
Sbjct: 142 NGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLD 199


>X95525-1|CAA64777.1|  799|Homo sapiens hTAFII100 protein.
          Length = 799

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 22/79 (27%), Positives = 38/79 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G +  +  +P     + + + D  +++W +      +G+    L GH+  +  +  S
Sbjct: 667 GHKGPIHSLTFSPN-GRFLATGATDGRVLLWDI-----GHGLMVGELKGHTDTVCSLRFS 720

Query: 257 SDGNYALSGSWDKTLRLWD 313
            DG    SGS D T+RLWD
Sbjct: 721 RDGEILASGSMDNTVRLWD 739



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 26/93 (27%), Positives = 40/93 (43%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GHN  V     +P Y    +S   D+   +W     +     P +   GH   ++    
Sbjct: 582 KGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQ-----PLRIFAGHLADVNCTRF 635

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS D+T+RLWD+  G   R F  H
Sbjct: 636 HPNSNYVATGSADRTVRLWDVLNGNCVRIFTGH 668



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 30/94 (31%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+G V   + +P   + +LSSS D T+ +W L       G       GH++ + D  
Sbjct: 539 LYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYK-----GHNYPVWDTQ 592

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S  G Y +SG  D+  RLW     +  R F  H
Sbjct: 593 FSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGH 626



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 19/36 (52%), Positives = 21/36 (58%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           K LYGHS  +     S D NY LS S D T+RLW L
Sbjct: 537 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSL 572



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 18/75 (24%), Positives = 33/75 (44%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + S D+T+ +W +       G   +   GH   I  +  S +G +  +G+ D  + LW
Sbjct: 642 VATGSADRTVRLWDVLN-----GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLW 696

Query: 311 DLAAGKTTRRFEDHT 355
           D+  G      + HT
Sbjct: 697 DIGHGLMVGELKGHT 711


>U80191-1|AAC51215.1|  800|Homo sapiens TFIID subunit TAFII100
           protein.
          Length = 800

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 22/79 (27%), Positives = 38/79 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G +  +  +P     + + + D  +++W +      +G+    L GH+  +  +  S
Sbjct: 667 GHKGPIHSLTFSPN-GRFLATGATDGRVLLWDI-----GHGLMVGELKGHTDTVCSLRFS 720

Query: 257 SDGNYALSGSWDKTLRLWD 313
            DG    SGS D T+RLWD
Sbjct: 721 RDGEILASGSMDNTVRLWD 739



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 26/93 (27%), Positives = 40/93 (43%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GHN  V     +P Y    +S   D+   +W     +     P +   GH   ++    
Sbjct: 582 KGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQ-----PLRIFAGHLADVNCTRF 635

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS D+T+RLWD+  G   R F  H
Sbjct: 636 HPNSNYVATGSADRTVRLWDVLNGNCVRIFTGH 668



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 30/94 (31%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+G V   + +P   + +LSSS D T+ +W L       G       GH++ + D  
Sbjct: 539 LYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYK-----GHNYPVWDTQ 592

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S  G Y +SG  D+  RLW     +  R F  H
Sbjct: 593 FSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGH 626



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 19/36 (52%), Positives = 21/36 (58%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           K LYGHS  +     S D NY LS S D T+RLW L
Sbjct: 537 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSL 572



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 18/75 (24%), Positives = 33/75 (44%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + S D+T+ +W +       G   +   GH   I  +  S +G +  +G+ D  + LW
Sbjct: 642 VATGSADRTVRLWDVLN-----GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLW 696

Query: 311 DLAAGKTTRRFEDHT 355
           D+  G      + HT
Sbjct: 697 DIGHGLMVGELKGHT 711


>U75309-1|AAC50902.1|  801|Homo sapiens TBP-associated factor
           protein.
          Length = 801

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 22/79 (27%), Positives = 38/79 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G +  +  +P     + + + D  +++W +      +G+    L GH+  +  +  S
Sbjct: 668 GHKGPIHSLTFSPN-GRFLATGATDGRVLLWDI-----GHGLMVGELKGHTDTVCSLRFS 721

Query: 257 SDGNYALSGSWDKTLRLWD 313
            DG    SGS D T+RLWD
Sbjct: 722 RDGEILASGSMDNTVRLWD 740



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 26/93 (27%), Positives = 40/93 (43%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GHN  V     +P Y    +S   D+   +W     +     P +   GH   ++    
Sbjct: 583 KGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQ-----PLRIFAGHLADVNCTRF 636

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS D+T+RLWD+  G   R F  H
Sbjct: 637 HPNSNYVATGSADRTVRLWDVLNGNCVRIFTGH 669



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 30/94 (31%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+G V   + +P   + +LSSS D T+ +W L       G       GH++ + D  
Sbjct: 540 LYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYK-----GHNYPVWDTQ 593

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S  G Y +SG  D+  RLW     +  R F  H
Sbjct: 594 FSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGH 627



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 19/36 (52%), Positives = 21/36 (58%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           K LYGHS  +     S D NY LS S D T+RLW L
Sbjct: 538 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSL 573



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 18/75 (24%), Positives = 33/75 (44%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + S D+T+ +W +       G   +   GH   I  +  S +G +  +G+ D  + LW
Sbjct: 643 VATGSADRTVRLWDVLN-----GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLW 697

Query: 311 DLAAGKTTRRFEDHT 355
           D+  G      + HT
Sbjct: 698 DIGHGLMVGELKGHT 712


>M36429-1|AAA63264.1|  340|Homo sapiens protein ( Human transducin
           beta-2 subunit mRNA, complete cds. ).
          Length = 340

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 25/94 (26%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D T  +W +   +   G       GHS  +  + 
Sbjct: 139 LPGHTGYLS--CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFA-----GHSGDVMSLS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+ DG   +SG+ D +++LWD+      + F  H
Sbjct: 192 LAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGH 225



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L GH + +S + ++ DG    +GSWD  L++W+
Sbjct: 308 LAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340


>M16514-1|AAA03179.1|  340|Homo sapiens GNB2 protein.
          Length = 340

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 25/94 (26%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D T  +W +   +   G       GHS  +  + 
Sbjct: 139 LPGHTGYLS--CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFA-----GHSGDVMSLS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+ DG   +SG+ D +++LWD+      + F  H
Sbjct: 192 LAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGH 225



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L GH + +S + ++ DG    +GSWD  L++W+
Sbjct: 308 LAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340


>EF079890-1|ABN48555.1|  444|Homo sapiens ATG16 autophagy related
           16-like protein 1 protein.
          Length = 444

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 29/103 (28%), Positives = 48/103 (46%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G     K +    E  + +G+L G N  +T I  +      +L++S D    +W +    
Sbjct: 178 GMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSA-GSYLLAASNDFASRIWTV---- 232

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++Y + +  L GHS  +       D    +SGS D+TL+LWDL
Sbjct: 233 DDYRL-RHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDL 274



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 30/97 (30%), Positives = 46/97 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A        I+S S D+TL +W L        +  K ++  S  
Sbjct: 236 RLRHTLTGHSGKVLS-AKFLLDNARIVSGSHDRTLKLWDLRSK-----VCIKTVFAGSS- 288

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +D+V +      +SG +DK +R WD+ +    R  E
Sbjct: 289 CNDIVCTEQ--CVMSGHFDKKIRFWDIRSESIVREME 323



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 25/84 (29%), Positives = 40/84 (47%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G +T +  NP+  ++ LS SRD  L V  L  +              S + + VV S DG
Sbjct: 326 GKITALDLNPERTEL-LSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDW-TRVVFSPDG 383

Query: 266 NYALSGSWDKTLRLWDLAAGKTTR 337
           +Y  +GS + +L +W +  GK  +
Sbjct: 384 SYVAAGSAEGSLYIWSVLTGKVEK 407


>EF079889-1|ABN48554.1|  588|Homo sapiens ATG16 autophagy related
           16-like protein 1 protein.
          Length = 588

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 29/103 (28%), Positives = 48/103 (46%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G     K +    E  + +G+L G N  +T I  +      +L++S D    +W +    
Sbjct: 322 GMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSA-GSYLLAASNDFASRIWTV---- 376

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++Y + +  L GHS  +       D    +SGS D+TL+LWDL
Sbjct: 377 DDYRL-RHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDL 418



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 30/97 (30%), Positives = 46/97 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A        I+S S D+TL +W L        +  K ++  S  
Sbjct: 380 RLRHTLTGHSGKVLS-AKFLLDNARIVSGSHDRTLKLWDLRSK-----VCIKTVFAGSS- 432

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +D+V +      +SG +DK +R WD+ +    R  E
Sbjct: 433 CNDIVCTEQ--CVMSGHFDKKIRFWDIRSESIVREME 467



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 25/84 (29%), Positives = 40/84 (47%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G +T +  NP+  ++ LS SRD  L V  L  +              S + + VV S DG
Sbjct: 470 GKITALDLNPERTEL-LSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDW-TRVVFSPDG 527

Query: 266 NYALSGSWDKTLRLWDLAAGKTTR 337
           +Y  +GS + +L +W +  GK  +
Sbjct: 528 SYVAAGSAEGSLYIWSVLTGKVEK 551


>CR541729-1|CAG46530.1|  340|Homo sapiens GNB2 protein.
          Length = 340

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 25/94 (26%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D T  +W +   +   G       GHS  +  + 
Sbjct: 139 LPGHTGYLS--CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFA-----GHSGDVMSLS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+ DG   +SG+ D +++LWD+      + F  H
Sbjct: 192 LAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGH 225



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L GH + +S + ++ DG    +GSWD  L++W+
Sbjct: 308 LAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340


>BC117337-1|AAI17338.1|  523|Homo sapiens ATG16L1 protein protein.
          Length = 523

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 29/103 (28%), Positives = 48/103 (46%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G     K +    E  + +G+L G N  +T I  +      +L++S D    +W +    
Sbjct: 257 GMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSA-GSYLLAASNDFASRIWTV---- 311

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++Y + +  L GHS  +       D    +SGS D+TL+LWDL
Sbjct: 312 DDYRL-RHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDL 353



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 30/97 (30%), Positives = 46/97 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A        I+S S D+TL +W L        +  K ++  S  
Sbjct: 315 RLRHTLTGHSGKVLS-AKFLLDNARIVSGSHDRTLKLWDLRSK-----VCIKTVFAGSS- 367

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +D+V +      +SG +DK +R WD+ +    R  E
Sbjct: 368 CNDIVCTEQ--CVMSGHFDKKIRFWDIRSESIVREME 402



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 25/84 (29%), Positives = 40/84 (47%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G +T +  NP+  ++ LS SRD  L V  L  +              S + + VV S DG
Sbjct: 405 GKITALDLNPERTEL-LSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDW-TRVVFSPDG 462

Query: 266 NYALSGSWDKTLRLWDLAAGKTTR 337
           +Y  +GS + +L +W +  GK  +
Sbjct: 463 SYVAAGSAEGSLYIWSVLTGKVEK 486


>BC071846-1|AAH71846.1|  475|Homo sapiens ATG16L1 protein protein.
          Length = 475

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 29/103 (28%), Positives = 48/103 (46%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G     K +    E  + +G+L G N  +T I  +      +L++S D    +W +    
Sbjct: 209 GMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSA-GSYLLAASNDFASRIWTV---- 263

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++Y + +  L GHS  +       D    +SGS D+TL+LWDL
Sbjct: 264 DDYRL-RHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDL 305



 Score = 37.1 bits (82), Expect = 0.051
 Identities = 30/97 (30%), Positives = 46/97 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A        I+S S D+TL +W L        +  K ++  S  
Sbjct: 267 RLRHTLTGHSGKVLS-AKFLLDNARIVSGSHDRTLKLWDLRSK-----VCIKTVFAGSS- 319

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +D+V +      +SG +DK +R WD+ +    R  E
Sbjct: 320 CNDIVCTEQ--CVMSGHFDKKIRFWDIRSESIVREME 354



 Score = 34.7 bits (76), Expect = 0.27
 Identities = 25/84 (29%), Positives = 40/84 (47%)
 Frame = +2

Query: 86  GWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDG 265
           G +T +  NP+  ++ LS SRD  L V  L  +              S + + VV S DG
Sbjct: 357 GKITALDLNPERTEL-LSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDW-TRVVFSPDG 414

Query: 266 NYALSGSWDKTLRLWDLAAGKTTR 337
           +Y  +GS + +L +W +  GK  +
Sbjct: 415 SYVAAGSAEGSLYIWSVLTGKVEK 438


>BC068003-1|AAH68003.1|  340|Homo sapiens guanine nucleotide binding
           protein (G protein), beta polypeptide 2 protein.
          Length = 340

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 25/94 (26%), Positives = 44/94 (46%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D T  +W +   +   G       GHS  +  + 
Sbjct: 139 LPGHTGYLS--CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFA-----GHSGDVMSLS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+ DG   +SG+ D +++LWD+      + F  H
Sbjct: 192 LAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGH 225



 Score = 32.7 bits (71), Expect = 1.1
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           L GH + +S + ++ DG    +GSWD  L++W+
Sbjct: 308 LAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 340


>BC052268-1|AAH52268.2|  800|Homo sapiens TAF5 RNA polymerase II,
           TATA box binding protein (TBP)-associated factor, 100kD
           protein.
          Length = 800

 Score = 41.5 bits (93), Expect = 0.002
 Identities = 22/79 (27%), Positives = 38/79 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G +  +  +P     + + + D  +++W +      +G+    L GH+  +  +  S
Sbjct: 667 GHKGPIHSLTFSPN-GRFLATGATDGRVLLWDI-----GHGLMVGELKGHTDTVCSLRFS 720

Query: 257 SDGNYALSGSWDKTLRLWD 313
            DG    SGS D T+RLWD
Sbjct: 721 RDGEILASGSMDNTVRLWD 739



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 26/93 (27%), Positives = 40/93 (43%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVL 253
           +GHN  V     +P Y    +S   D+   +W     +     P +   GH   ++    
Sbjct: 582 KGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQ-----PLRIFAGHLADVNCTRF 635

Query: 254 SSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             + NY  +GS D+T+RLWD+  G   R F  H
Sbjct: 636 HPNSNYVATGSADRTVRLWDVLNGNCVRIFTGH 668



 Score = 39.9 bits (89), Expect = 0.007
 Identities = 30/94 (31%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+G V   + +P   + +LSSS D T+ +W L       G       GH++ + D  
Sbjct: 539 LYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYK-----GHNYPVWDTQ 592

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S  G Y +SG  D+  RLW     +  R F  H
Sbjct: 593 FSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGH 626



 Score = 38.3 bits (85), Expect = 0.022
 Identities = 19/36 (52%), Positives = 21/36 (58%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           K LYGHS  +     S D NY LS S D T+RLW L
Sbjct: 537 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSL 572



 Score = 32.3 bits (70), Expect = 1.4
 Identities = 18/75 (24%), Positives = 33/75 (44%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + + S D+T+ +W +       G   +   GH   I  +  S +G +  +G+ D  + LW
Sbjct: 642 VATGSADRTVRLWDVLN-----GNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLW 696

Query: 311 DLAAGKTTRRFEDHT 355
           D+  G      + HT
Sbjct: 697 DIGHGLMVGELKGHT 711


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 84,245,931
Number of Sequences: 237096
Number of extensions: 1668499
Number of successful extensions: 6918
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 4319
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6350
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6804036910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -