SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A04
         (587 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF181719-1|AAF78364.1|  407|Homo sapiens DAZ associated protein ...   143   4e-34
BC012062-1|AAH12062.1|  407|Homo sapiens DAZ associated protein ...   142   6e-34
AY678451-1|AAV97647.1|  454|Homo sapiens DAZAP1/MEF2D fusion pro...   142   6e-34
BC001526-1|AAH01526.1|  328|Homo sapiens musashi homolog 2 (Dros...   122   9e-28
AK093888-1|BAC04244.1|  251|Homo sapiens protein ( Homo sapiens ...   119   7e-27
AC003982-3|AAB95636.1|  362|Homo sapiens WUGSC:H_166H1.2 protein.     116   5e-26
AB012851-1|BAA33962.1|  362|Homo sapiens Musashi protein.             116   5e-26
BC036708-1|AAH36708.1|  332|Homo sapiens heterogeneous nuclear r...   114   3e-25
BC009359-1|AAH09359.1|  285|Homo sapiens heterogeneous nuclear r...   114   3e-25
BC004561-1|AAH04561.1|  285|Homo sapiens heterogeneous nuclear r...   114   3e-25
BC002625-1|AAH02625.1|  285|Homo sapiens heterogeneous nuclear r...   114   3e-25
BC001616-1|AAH01616.1|  285|Homo sapiens heterogeneous nuclear r...   114   3e-25
AK223425-1|BAD97145.1|  332|Homo sapiens heterogeneous nuclear r...   114   3e-25
AK097657-1|BAC05134.1|  332|Homo sapiens protein ( Homo sapiens ...   114   3e-25
D89092-1|BAA24361.1|  301|Homo sapiens hnRNP JKTBP protein.           113   3e-25
CR407623-1|CAG28551.1|  420|Homo sapiens HNRPDL protein.              113   3e-25
BC071944-1|AAH71944.1|  420|Homo sapiens heterogeneous nuclear r...   113   3e-25
BC011714-1|AAH11714.1|  420|Homo sapiens heterogeneous nuclear r...   113   3e-25
BC007392-1|AAH07392.2|  415|Homo sapiens HNRPDL protein protein.      113   3e-25
AY453824-1|AAR17782.1|  298|Homo sapiens CArG binding factor pro...   113   3e-25
AC124016-2|AAY40914.1|  420|Homo sapiens unknown protein.             113   3e-25
AB066484-1|BAB62188.1|  244|Homo sapiens JKTBP1delta6 protein.        113   3e-25
AB017019-1|BAA75241.1|  420|Homo sapiens JKTBP2 protein.              113   3e-25
AB017018-2|BAA75240.1|  301|Homo sapiens JKTBP1 protein.              113   3e-25
AB017018-1|BAA75239.1|  420|Homo sapiens JKTBP2 protein.              113   3e-25
U76713-1|AAC50956.1|  331|Homo sapiens ABBP-1 protein.                112   1e-24
M65028-1|AAA36575.1|  284|Homo sapiens hnRNP type A/B protein pr...   112   1e-24
U02019-1|AAC50056.1|  286|Homo sapiens p37 AUF1 protein.              109   7e-24
AF026126-3|AAC23476.1|  336|Homo sapiens heterogeneous nuclear r...   109   7e-24
D55671-1|BAA09522.1|  267|Homo sapiens heterogeneous nuclear rib...   106   5e-23
D89678-1|BAA22860.1|  271|Homo sapiens A+U-rich element RNA bind...   103   4e-22
D55674-1|BAA09525.1|  355|Homo sapiens heterogeneous nuclear rib...   102   8e-22
D55673-1|BAA09524.1|  215|Homo sapiens heterogeneous nuclear rib...   102   8e-22
D55672-1|BAA09523.1|  306|Homo sapiens heterogeneous nuclear rib...   102   8e-22
BC026015-1|AAH26015.1|  306|Homo sapiens heterogeneous nuclear r...   102   8e-22
BC023977-1|AAH23977.1|  306|Homo sapiens heterogeneous nuclear r...   102   8e-22
BC002401-1|AAH02401.1|  355|Homo sapiens heterogeneous nuclear r...   102   8e-22
AF039575-1|AAB96683.1|  298|Homo sapiens heterogeneous nuclear r...   102   8e-22
AF026126-2|AAC23475.1|  306|Homo sapiens heterogeneous nuclear r...   102   8e-22
AF026126-1|AAC23474.1|  355|Homo sapiens heterogeneous nuclear r...   102   8e-22
AC124016-1|AAY40913.1|  355|Homo sapiens unknown protein.             102   8e-22
M94630-1|AAA35781.1|  328|Homo sapiens DNA-binding protein protein.   102   1e-21
U09123-1|AAB60650.1|  341|Homo sapiens hnRNP protein A2 protein.      101   2e-21
M29065-1|AAA36574.1|  341|Homo sapiens protein ( Human hnRNP A2 ...   101   2e-21
D28877-2|BAA06032.1|  341|Homo sapiens hnRNP A2 protein protein.      101   2e-21
BC000506-1|AAH00506.3|  249|Homo sapiens HNRPA2B1 protein protein.    101   2e-21
M29064-1|AAA60271.1|  353|Homo sapiens SNRPB1 protein.                101   2e-21
D28877-1|BAA06031.1|  353|Homo sapiens hnRNP B1 protein protein.      101   2e-21
BC108266-1|AAI08267.1|  320|Homo sapiens heterogeneous nuclear r...    99   6e-21
AL137058-3|CAI16736.1|  320|Homo sapiens protein ( Human DNA seq...    99   6e-21
X79536-1|CAA56072.1|  320|Homo sapiens hnRNPcore protein A1 prot...    99   1e-20
X12671-1|CAA31191.1|  320|Homo sapiens hnrnp a1 protein protein.       99   1e-20
X06747-1|CAA29922.1|  320|Homo sapiens protein ( Human hnRNP cor...    99   1e-20
BC121133-1|AAI21134.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC103707-1|AAI03708.1|  267|Homo sapiens HNRPA1 protein protein.       99   1e-20
BC074502-1|AAH74502.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC073162-1|AAH73162.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC071945-1|AAH71945.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC070315-1|AAH70315.1|  320|Homo sapiens HNRPA1 protein protein.       99   1e-20
BC052296-1|AAH52296.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC033714-1|AAH33714.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC012158-1|AAH12158.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC009600-1|AAH09600.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC002355-1|AAH02355.1|  320|Homo sapiens heterogeneous nuclear r...    99   1e-20
BC113470-1|AAI13471.1|  378|Homo sapiens LOC653115 protein protein.    95   1e-19
BC112027-1|AAI12028.1|  378|Homo sapiens heterogeneous nuclear r...    95   1e-19
AY363225-1|AAQ63629.1|  378|Homo sapiens heterogeneous nuclear r...    95   1e-19
AC079305-1|AAY14709.1|  378|Homo sapiens unknown protein.              95   1e-19
S63912-1|AAB27595.1|  269|Homo sapiens FBRNP protein.                  89   1e-17
U23803-1|AAA65094.1|  305|Homo sapiens heterogeneous ribonucleop...    85   1e-16
CR456986-1|CAG33267.1|  305|Homo sapiens HNRPA0 protein.               85   1e-16
BC030249-1|AAH30249.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC028976-1|AAH28976.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC019271-1|AAH19271.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC018949-1|AAH18949.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC012980-1|AAH12980.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC011972-1|AAH11972.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC009284-1|AAH09284.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC007271-1|AAH07271.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC001008-1|AAH01008.1|  305|Homo sapiens heterogeneous nuclear r...    85   1e-16
BC004945-1|AAH04945.1|  298|Homo sapiens Unknown (protein for IM...    83   5e-16
U28686-1|AAB17212.1|  157|Homo sapiens RNPL protein.                   75   2e-13
D78134-1|BAA11212.1|  172|Homo sapiens CIRP protein.                   75   2e-13
BT007210-1|AAP35874.1|  172|Homo sapiens cold inducible RNA bind...    75   2e-13
BC006825-1|AAH06825.1|  157|Homo sapiens RNA binding motif (RNP1...    75   2e-13
BC000901-1|AAH00901.1|  172|Homo sapiens cold inducible RNA bind...    75   2e-13
BC000403-1|AAH00403.1|  172|Homo sapiens cold inducible RNA bind...    75   2e-13
AF021336-1|AAC51787.1|  172|Homo sapiens DNA damage-inducible RN...    75   2e-13
AC004258-1|AAC04895.1|  172|Homo sapiens CIRP protein.                 75   2e-13
U23731-1|AAA70033.1|  414|Homo sapiens TAR DNA-binding protein-4...    74   3e-13
EF434182-1|ABO32291.1|  414|Homo sapiens TDP43 splice variant 1 ...    74   3e-13
EF434181-1|ABO32290.1|  416|Homo sapiens TDP43 protein.                74   3e-13
CR533534-1|CAG38565.1|  414|Homo sapiens TARDBP protein.               74   3e-13
BC095435-1|AAH95435.1|  414|Homo sapiens TAR DNA binding protein...    74   3e-13
BC071657-1|AAH71657.1|  414|Homo sapiens TARDBP protein protein.       74   3e-13
AL109811-2|CAI22099.1|  295|Homo sapiens TAR DNA binding protein...    74   3e-13
AL109811-1|CAI22098.1|  414|Homo sapiens TAR DNA binding protein...    74   3e-13
AK222754-1|BAD96474.1|  414|Homo sapiens TAR DNA binding protein...    74   3e-13
AK128423-1|BAC87434.1|  135|Homo sapiens protein ( Homo sapiens ...    72   2e-12
AF069682-1|AAC24858.2|  392|Homo sapiens testes specific heterog...    72   2e-12
Z23064-1|CAA80599.1|  391|Homo sapiens hnRNP G protein protein.        71   2e-12
BC007435-1|AAH07435.1|  391|Homo sapiens RNA binding motif prote...    71   2e-12
BC006550-1|AAH06550.1|  391|Homo sapiens RNA binding motif prote...    71   2e-12
AY464692-1|AAR28036.1|  391|Homo sapiens heterogeneous nuclear r...    71   2e-12
AL683813-6|CAI39448.1|  391|Homo sapiens RNA binding motif prote...    71   2e-12
AF266723-1|AAK58567.1|  391|Homo sapiens RBMX protein.                 71   2e-12
AB073212-1|BAB70469.1|  179|Homo sapiens Musashi1 protein.             71   2e-12
AB072592-1|BAB69769.1|  181|Homo sapiens Musashi1 protein.             71   2e-12
AB072591-1|BAB69768.1|  181|Homo sapiens Musashi1 protein.             71   2e-12
AB072590-1|BAB69767.1|  180|Homo sapiens Musashi1 protein.             71   2e-12
BC057796-1|AAH57796.1|  392|Homo sapiens RNA binding motif prote...    70   5e-12
AF279289-1|AAF82129.1|  386|Homo sapiens testes-specific heterog...    70   5e-12
DQ120650-1|ABB92435.1|  384|Homo sapiens RBM1 protein.                 69   9e-12
BC012942-1|AAH12942.1|  390|Homo sapiens RNA binding motif prote...    69   9e-12
AL139416-3|CAI21694.1|  159|Homo sapiens RNA binding motif prote...    69   9e-12
AL139416-2|CAI21693.1|  390|Homo sapiens RNA binding motif prote...    69   9e-12
AK056850-1|BAB71295.1|  289|Homo sapiens protein ( Homo sapiens ...    69   9e-12
BC017560-1|AAH17560.1|  151|Homo sapiens MSI2 protein protein.         68   2e-11
AY547318-1|AAS55633.1|  236|Homo sapiens unknown protein.              65   2e-10
AL136305-1|CAC36889.1|  236|Homo sapiens protein ( Human DNA seq...    65   2e-10
AK095016-1|BAC04474.1|  211|Homo sapiens protein ( Homo sapiens ...    65   2e-10
BC018711-1|AAH18711.1|  216|Homo sapiens RBM38 protein protein.        64   5e-10
AF432218-1|AAL99924.1|  216|Homo sapiens CLL-associated antigen ...    64   5e-10
X75315-1|CAA53064.1|  230|Homo sapiens SEB4B protein.                  63   8e-10
X75314-1|CAA53063.1|  229|Homo sapiens SEB4D protein.                  63   8e-10
U36608-1|AAC16917.1|  220|Homo sapiens Y-chromosome RNA recognit...    60   4e-09
AL354775-1|CAI12730.1|  276|Homo sapiens protein ( Human DNA seq...    60   6e-09
X76059-1|CAA53659.1|  496|Homo sapiens protein ( H.sapiens mRNA ...    59   1e-08
BC070298-1|AAH70298.1|  459|Homo sapiens RBMY1A1 protein protein.      59   1e-08
X76060-1|CAA53660.1|  419|Homo sapiens YRRM2 protein.                  58   3e-08
BC030018-1|AAH30018.1|  496|Homo sapiens RNA binding motif prote...    58   3e-08
BC024208-1|AAH24208.1|  423|Homo sapiens RNA binding motif prote...    55   2e-07
BC002566-1|AAH02566.1|  424|Homo sapiens RNA binding motif prote...    55   2e-07
AK001344-1|BAA91638.1|  406|Homo sapiens protein ( Homo sapiens ...    55   2e-07
AF275678-1|AAG24388.1|  418|Homo sapiens PP239 protein protein.        55   2e-07
AF087905-1|AAP97203.1|  425|Homo sapiens splicing factor SF2 pro...    54   5e-07
AC016700-3|AAX93193.1|  386|Homo sapiens unknown protein.              53   7e-07
CR457257-1|CAG33538.1|  423|Homo sapiens RNPC4 protein.                53   9e-07
BC033674-1|AAH33674.1|  283|Homo sapiens bol, boule-like (Drosop...    53   9e-07
AM295005-1|CAL25726.1|  289|Homo sapiens boll protein protein.         53   9e-07
AK093453-1|BAC04171.1|  339|Homo sapiens protein ( Homo sapiens ...    53   9e-07
AK058099-1|BAB71664.1|  283|Homo sapiens protein ( Homo sapiens ...    53   9e-07
AF272858-1|AAK58689.1|  283|Homo sapiens BOULE protein.                53   9e-07
AC011997-1|AAX93045.1|  283|Homo sapiens unknown protein.              53   9e-07
U29943-1|AAA70417.1|  346|Homo sapiens Hel-N2 protein.                 52   2e-06
U12431-1|AAA69698.1|  359|Homo sapiens ELAV-like neuronal protei...    52   2e-06
M62843-1|AAA58396.1|  380|Homo sapiens brain protein protein.          52   2e-06
BC036071-1|AAH36071.1|  366|Homo sapiens ELAVL4 protein protein.       52   2e-06
BC030692-1|AAH30692.1|  346|Homo sapiens ELAVL2 protein protein.       52   2e-06
AY033998-1|AAK57541.1|  380|Homo sapiens HUDPRO1 protein.              52   2e-06
AY033997-1|AAK57540.1|  366|Homo sapiens HUD1 protein.                 52   2e-06
AY033996-1|AAK57539.1|  383|Homo sapiens HUD4 protein.                 52   2e-06
AY033995-1|AAK57538.1|  366|Homo sapiens HUD3 protein.                 52   2e-06
AL592182-6|CAI15792.1|  385|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL592182-5|CAI15793.1|  371|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL592182-4|CAI15791.1|  380|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL592182-3|CAI15790.1|  366|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL592182-2|CAI15789.1|  383|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL592182-1|CAI15788.1|  366|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL583843-6|CAI14638.1|  385|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL583843-5|CAI14639.1|  371|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL583843-4|CAI14637.1|  380|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL583843-3|CAI14636.1|  366|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL583843-2|CAI14635.1|  383|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL583843-1|CAI14634.1|  366|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL161628-4|CAI13378.1|  387|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL161628-3|CAI13377.1|  189|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL161628-2|CAC22160.1|  359|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AL161628-1|CAI13376.1|  346|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
AB209294-1|BAD92531.1|  367|Homo sapiens ELAV (embryonic lethal,...    52   2e-06
L10911-1|AAA16347.1|  530|Homo sapiens splicing factor protein.        51   3e-06
L10910-1|AAA16346.1|  524|Homo sapiens splicing factor protein.        51   3e-06
BX537770-1|CAD97833.1|  373|Homo sapiens hypothetical protein pr...    51   3e-06
BC141835-1|AAI41836.1|  530|Homo sapiens RNA binding motif prote...    51   3e-06
BC131543-1|AAI31544.1|  508|Homo sapiens RBM39 protein protein.        51   3e-06
AL357374-9|CAC11119.1|  524|Homo sapiens RNA binding motif prote...    51   3e-06
AL357374-8|CAC11118.1|  530|Homo sapiens RNA binding motif prote...    51   3e-06
BC015944-1|AAH15944.1|  214|Homo sapiens TIA1 protein protein.         51   3e-06
AB209211-1|BAD92448.1|  464|Homo sapiens TIA1 protein variant pr...    51   3e-06
M96954-1|AAA36384.1|  375|Homo sapiens nucleolysin TIAR protein.       50   5e-06
D64015-1|BAA21559.1|  265|Homo sapiens T-cluster binding protein...    50   5e-06
AY633610-1|AAV33303.1|  374|Homo sapiens aging-associated gene 7...    50   5e-06
U53209-1|AAC50658.1|  282|Homo sapiens transformer-2 alpha protein.    50   6e-06
BC017094-1|AAH17094.1|  282|Homo sapiens transformer-2 alpha pro...    50   6e-06
AC023105-1|AAQ96870.1|  282|Homo sapiens unknown protein.              50   6e-06
AB097048-1|BAC77401.1|  282|Homo sapiens putative MAPK activatin...    50   6e-06
BC105582-1|AAI05583.1|  173|Homo sapiens RBMX2 protein protein.        50   8e-06
BC033750-1|AAH33750.1|  322|Homo sapiens RNA binding motif prote...    50   8e-06
BC003676-1|AAH03676.1|  163|Homo sapiens Unknown (protein for IM...    50   8e-06
AL050405-1|CAB43745.1|  322|Homo sapiens hypothetical protein pr...    50   8e-06
AL035423-8|CAI42444.1|  322|Homo sapiens RNA binding motif prote...    50   8e-06
AF151837-1|AAD34074.1|  351|Homo sapiens CGI-79 protein protein.       50   8e-06
BC028101-1|AAH28101.1|  485|Homo sapiens bruno-like 5, RNA bindi...    49   1e-05
AF329266-1|AAK07476.1|  481|Homo sapiens CUG-BP and ETR-3 like f...    49   1e-05
AB210019-1|BAE06101.1|  544|Homo sapiens CUGBP1 variant protein ...    49   1e-05
AB209067-1|BAD92304.1|  421|Homo sapiens bruno-like 5, RNA bindi...    49   1e-05
D26158-1|BAA21838.1|  350|Homo sapiens PLE21 protein protein.          49   1e-05
BC066549-1|AAH66549.1|  474|Homo sapiens RNA binding motif prote...    49   1e-05
BC026077-1|AAH26077.1|  161|Homo sapiens RBMY2FP protein protein.      49   1e-05
BC014144-1|AAH14144.1|  367|Homo sapiens ELAVL3 protein protein.       49   1e-05
AF526533-1|AAM88417.1|  328|Homo sapiens putative RNA binding pr...    49   1e-05
AB036991-1|BAC16207.1|  476|Homo sapiens developmentally regulat...    49   1e-05
AK096015-1|BAC04674.1|  378|Homo sapiens protein ( Homo sapiens ...    48   2e-05
X03910-1|CAA27544.1|  225|Homo sapiens protein ( Human mRNA for ...    48   2e-05
U68063-1|AAB08701.1|  288|Homo sapiens transformer-2 beta protein.     48   2e-05
U61267-1|AAC28242.1|  288|Homo sapiens htra2-beta protein.             48   2e-05
L26405-1|AAA58677.1|  359|Homo sapiens huc protein.                    48   2e-05
BC031682-1|AAH31682.1|  450|Homo sapiens RBM42 protein protein.        48   2e-05
BC005898-1|AAH05898.1|  288|Homo sapiens splicing factor, argini...    48   2e-05
BC004204-1|AAH04204.1|  480|Homo sapiens hypothetical protein MG...    48   2e-05
BC002868-1|AAH02868.1|  451|Homo sapiens MGC10433 protein protein.     48   2e-05
BC000451-1|AAH00451.1|  288|Homo sapiens splicing factor, argini...    48   2e-05
BC000160-1|AAH00160.1|  288|Homo sapiens splicing factor, argini...    48   2e-05
AY036909-1|AAK67714.1|  360|Homo sapiens HUC protein.                  48   2e-05
AK098191-1|BAC05256.1|  252|Homo sapiens protein ( Homo sapiens ...    48   2e-05
AF057159-3|AAD19278.1|  188|Homo sapiens transformer-2-beta isof...    48   2e-05
AF057159-1|AAD19277.1|  288|Homo sapiens transformer-2-beta isof...    48   2e-05
AC002115-1|AAB57629.1|  339|Homo sapiens F25451_2 protein.             48   2e-05
AB209208-1|BAD92445.1|  278|Homo sapiens splicing factor, argini...    48   2e-05
BC022543-1|AAH22543.1|  217|Homo sapiens zinc finger CCHC-type a...    48   3e-05
BC010177-1|AAH10177.1|  140|Homo sapiens ZCRB1 protein protein.        48   3e-05
BC005099-1|AAH05099.1|  141|Homo sapiens Unknown (protein for IM...    48   3e-05
AB062361-1|BAB56132.1|  217|Homo sapiens ZCRB1 protein protein.        48   3e-05
BC047522-1|AAH47522.1|  402|Homo sapiens BRUNOL5 protein protein.      47   6e-05
U63289-1|AAC50895.1|  482|Homo sapiens CUG-BP/hNab50 protein.          46   8e-05
BC031079-1|AAH31079.1|  483|Homo sapiens CUG triplet repeat, RNA...    46   8e-05
BC017895-1|AAH17895.1|  109|Homo sapiens chromosome 14 open read...    46   8e-05
AY860853-1|AAX58600.1|  109|Homo sapiens SRA stem-loop-interacti...    46   8e-05
AJ272055-1|CAC81241.1|  109|Homo sapiens hypothetical protein pr...    46   8e-05
AJ007988-1|CAC20566.1|  486|Homo sapiens deadenylation factor CU...    46   8e-05
AF271779-1|AAG44790.1|  109|Homo sapiens DC50 protein.                 46   8e-05
AF267534-1|AAF78956.1|  483|Homo sapiens CUG-binding protein A i...    46   8e-05
AF267533-1|AAF78955.1|  486|Homo sapiens CUG-binding protein LYL...    46   8e-05
AF253980-1|AAG44629.1|  109|Homo sapiens DC23 protein.                 46   8e-05
AF248648-1|AAF86230.1|  486|Homo sapiens RNA-binding protein BRU...    46   8e-05
AF026564-1|AAC16916.1|  318|Homo sapiens RNA binding protein pro...    46   8e-05
BC006137-1|AAH06137.1|  960|Homo sapiens RBM19 protein protein.        46   1e-04
BC004289-1|AAH04289.1|  960|Homo sapiens RBM19 protein protein.        46   1e-04
AB014582-1|BAA31657.2|  973|Homo sapiens KIAA0682 protein protein.     46   1e-04
X84841-1|CAA59278.1|  437|Homo sapiens 68 kDa (U1) ribonucleopro...    45   2e-04
X06812-1|CAA29961.1|  301|Homo sapiens protein ( Human mRNA for ...    45   2e-04
X04654-1|CAA28352.1|  614|Homo sapiens protein ( Human mRNA for ...    45   2e-04
M57939-2|AAA36573.1|  428|Homo sapiens ribonucleoprotein antigen...    45   2e-04
M57939-1|AAA36572.1|  437|Homo sapiens ribonucleoprotein antigen...    45   2e-04
M22636-1|AAA03001.1|  437|Homo sapiens protein ( Human U1 small ...    45   2e-04
BC029451-1|AAH29451.1|  425|Homo sapiens RNA binding motif prote...    45   2e-04
BC001315-1|AAH01315.1|  437|Homo sapiens small nuclear ribonucle...    45   2e-04
AL732292-3|CAM28277.1|  408|Homo sapiens novel protein protein.        45   2e-04
AL732292-2|CAI21936.1|  430|Homo sapiens RNA binding motif prote...    45   2e-04
AL133418-4|CAM28326.1|  408|Homo sapiens novel protein protein.        45   2e-04
AL133418-3|CAI22960.1|  430|Homo sapiens RNA binding motif prote...    45   2e-04
U32519-1|AAB07787.1|  466|Homo sapiens GAP SH3 binding protein p...    45   2e-04
CR536535-1|CAG38772.1|  466|Homo sapiens G3BP protein.                 45   2e-04
BT019384-1|AAV38191.1|  466|Homo sapiens Ras-GTPase-activating p...    45   2e-04
BC028239-1|AAH28239.1|  616|Homo sapiens cleavage stimulation fa...    45   2e-04
BC013889-1|AAH13889.1|  759|Homo sapiens RNA binding motif prote...    45   2e-04
BC006997-1|AAH06997.1|  466|Homo sapiens GTPase activating prote...    45   2e-04
AY130299-1|AAN05429.1|  616|Homo sapiens tCstF-64 protein.             45   2e-04
AK222716-1|BAD96436.1|  759|Homo sapiens RNA binding motif prote...    45   2e-04
AK222606-1|BAD96326.1|  466|Homo sapiens Ras-GTPase-activating p...    45   2e-04
AK222574-1|BAD96294.1|  616|Homo sapiens cleavage stimulation fa...    45   2e-04
AK130003-1|BAC85272.1|  307|Homo sapiens protein ( Homo sapiens ...    45   2e-04
AK001239-1|BAA91575.1|  759|Homo sapiens protein ( Homo sapiens ...    45   2e-04
Z95327-3|CAI42680.1|  577|Homo sapiens cleavage stimulation fact...    44   4e-04
Z83819-6|CAB06072.2|  577|Homo sapiens cleavage stimulation fact...    44   4e-04
X75755-1|CAA53383.1|  221|Homo sapiens PR264/SC35 protein.             44   4e-04
X62447-1|CAA44307.1|  221|Homo sapiens PR 264 protein.                 44   4e-04
M85085-1|AAA35724.1|  577|Homo sapiens cleavage stimulation fact...    44   4e-04
BT009778-1|AAP88780.1|  577|Homo sapiens cleavage stimulation fa...    44   4e-04
BT007250-1|AAP35914.1|  221|Homo sapiens splicing factor, argini...    44   4e-04
BC070086-1|AAH70086.1|  221|Homo sapiens splicing factor, argini...    44   4e-04
BC066958-1|AAH66958.1|  179|Homo sapiens SFRS2 protein protein.        44   4e-04
BC033135-1|AAH33135.1|  559|Homo sapiens Similar to cleavage sti...    44   4e-04
BC017712-1|AAH17712.1|  577|Homo sapiens cleavage stimulation fa...    44   4e-04
BC001303-1|AAH01303.1|  221|Homo sapiens SFRS2 protein protein.        44   4e-04
BC000339-1|AAH00339.1|  221|Homo sapiens SFRS2 protein protein.        44   4e-04
AK223252-1|BAD96972.1|  221|Homo sapiens splicing factor, argini...    44   4e-04
AK093626-1|BAC04206.1|  186|Homo sapiens protein ( Homo sapiens ...    44   4e-04
AK092489-1|BAC03903.1|  201|Homo sapiens protein ( Homo sapiens ...    44   4e-04
DQ120640-1|ABB92425.1|  630|Homo sapiens PABP3 protein.                43   7e-04
BC057783-1|AAH57783.1|  275|Homo sapiens SFRS2B protein protein.       43   7e-04
BC045608-1|AAH45608.1|  631|Homo sapiens poly(A) binding protein...    43   7e-04
BC027617-1|AAH27617.1|  631|Homo sapiens poly(A) binding protein...    43   7e-04
BC010074-1|AAH10074.1|  173|Homo sapiens FUSIP1 protein protein.       43   7e-04
BC005039-1|AAH05039.1|  262|Homo sapiens FUS interacting protein...    43   7e-04
BC001107-1|AAH01107.1|  183|Homo sapiens FUS interacting protein...    43   7e-04
AY150181-1|AAN65381.1|  183|Homo sapiens splicing factor SRp38-2...    43   7e-04
AY150180-1|AAN65380.1|  262|Homo sapiens splicing factor SRp38 p...    43   7e-04
AY048592-2|AAL06099.1|  262|Homo sapiens TLS-associated SR prote...    43   7e-04
AY048592-1|AAL06098.1|  183|Homo sapiens TLS-associated SR prote...    43   7e-04
AL590609-10|CAI14808.1|  262|Homo sapiens FUS interacting protei...    43   7e-04
AL590609-9|CAI14807.1|  261|Homo sapiens FUS interacting protein...    43   7e-04
AL590609-8|CAI14805.1|  173|Homo sapiens FUS interacting protein...    43   7e-04
AL590609-7|CAI14806.1|  172|Homo sapiens FUS interacting protein...    43   7e-04
AL590609-6|CAI14803.1|  183|Homo sapiens FUS interacting protein...    43   7e-04
AL590609-5|CAI14804.1|  182|Homo sapiens FUS interacting protein...    43   7e-04
AL359757-1|CAH70805.1|  631|Homo sapiens poly(A) binding protein...    43   7e-04
AK222994-1|BAD96714.1|  262|Homo sapiens FUS interacting protein...    43   7e-04
AK001286-1|BAA91601.1|  183|Homo sapiens protein ( Homo sapiens ...    43   7e-04
AF449427-1|AAL57514.1|  262|Homo sapiens SRrp40 protein.               43   7e-04
AF419332-1|AAL16666.1|  261|Homo sapiens TLS-associated protein ...    43   7e-04
AF419331-1|AAL16665.1|  183|Homo sapiens TLS-associated protein ...    43   7e-04
AF132026-1|AAG38953.1|  631|Homo sapiens testis-specific poly(A)...    43   7e-04
AF067730-1|AAC26727.1|  262|Homo sapiens TLS-associated protein ...    43   7e-04
AF047448-1|AAC70918.1|  183|Homo sapiens TLS-associated protein ...    43   7e-04
AF031165-1|AAK54350.1|  282|Homo sapiens SRp46 splicing factor p...    43   7e-04
U96074-1|AAC78728.1|  320|Homo sapiens translation initiation fa...    43   0.001
U75686-1|AAB97309.1|  644|Homo sapiens polyadenylate binding pro...    43   0.001
U33818-1|AAC50350.1|  644|Homo sapiens inducible poly(A)-binding...    43   0.001
D12799-1|BAA02244.1|  193|Homo sapiens polyadenylate binding pro...    43   0.001
CR457134-1|CAG33415.1|  320|Homo sapiens EIF3S4 protein.               43   0.001
BT006889-1|AAP35535.1|  320|Homo sapiens eukaryotic translation ...    43   0.001
BC118568-1|AAI18569.1|  252|Homo sapiens PABPC4 protein protein.       43   0.001
BC106908-1|AAI06909.1|  281|Homo sapiens PABPC4 protein protein.       43   0.001
BC094755-1|AAH94755.1|  660|Homo sapiens PABPC4 protein protein.       43   0.001
BC071591-1|AAH71591.1|  660|Homo sapiens PABPC4 protein protein.       43   0.001
BC065540-1|AAH65540.1|  631|Homo sapiens PABPC4 protein protein.       43   0.001
BC008469-1|AAH08469.1|  320|Homo sapiens eukaryotic translation ...    43   0.001
BC000733-1|AAH00733.1|  320|Homo sapiens eukaryotic translation ...    43   0.001
AL845289-3|CAI12300.1|  644|Homo sapiens poly(A) binding protein...    43   0.001
AL845289-2|CAI12298.1|  660|Homo sapiens poly(A) binding protein...    43   0.001
AL845289-1|CAI12299.1|  615|Homo sapiens poly(A) binding protein...    43   0.001
AL365277-15|CAI16425.1|  410|Homo sapiens poly(A) binding protei...    43   0.001
AL365277-4|CAI16414.1|  644|Homo sapiens poly(A) binding protein...    43   0.001
AL365277-3|CAI16412.1|  660|Homo sapiens poly(A) binding protein...    43   0.001
AL365277-2|CAI16413.1|  615|Homo sapiens poly(A) binding protein...    43   0.001
AK222917-1|BAD96637.1|  371|Homo sapiens PABPC4 protein variant ...    43   0.001
AF094850-1|AAG15419.1|  320|Homo sapiens eukaryotic translation ...    43   0.001
AF092453-1|AAG15396.1|  320|Homo sapiens eukaryotic translation ...    43   0.001
AF020833-1|AAB71866.1|  320|Homo sapiens eukaryotic translation ...    43   0.001
Z48501-1|CAA88401.1|  522|Homo sapiens polyadenylate binding pro...    42   0.001
Y00345-1|CAA68428.1|  633|Homo sapiens protein ( Human mRNA for ...    42   0.001
U68104-1|AAD08718.1|  636|Homo sapiens poly(A)-binding protein p...    42   0.001
M60858-1|AAA59954.1|  707|Homo sapiens nucleolin protein.              42   0.001
D50928-1|BAA09487.2|  962|Homo sapiens KIAA0138 protein.               42   0.001
BC108278-1|AAI08279.1|  466|Homo sapiens GTPase activating prote...    42   0.001
BC041863-1|AAH41863.1|  636|Homo sapiens poly(A) binding protein...    42   0.001
BC025279-1|AAH25279.1|  528|Homo sapiens SAFB2 protein protein.        42   0.001
BC023520-1|AAH23520.1|  636|Homo sapiens poly(A) binding protein...    42   0.001
BC015958-1|AAH15958.1|  636|Homo sapiens PABPC1 protein protein.       42   0.001
BC014784-1|AAH14784.1|  526|Homo sapiens Unknown (protein for IM...    42   0.001
AY034002-1|AAK57545.1|  318|Homo sapiens Hu antigen C long protein.    42   0.001
AL109839-1|CAI95631.1|  614|Homo sapiens chromosome 20 open read...    42   0.001
AL008725-4|CAI95662.1|  614|Homo sapiens chromosome 20 open read...    42   0.001
AC004611-1|AAC14666.1|  953|Homo sapiens KIAA0138 protein.             42   0.001
BC033838-1|AAH33838.1|  368|Homo sapiens BRUNOL6 protein protein.      42   0.002
BC030835-1|AAH30835.1|  481|Homo sapiens bruno-like 6, RNA bindi...    42   0.002
AK131098-1|BAC85148.1|  376|Homo sapiens FLJ00324 protein protein.     42   0.002
AK126716-1|BAC86656.1|  250|Homo sapiens protein ( Homo sapiens ...    42   0.002
AK074596-1|BAC11082.1|  484|Homo sapiens protein ( Homo sapiens ...    42   0.002
AF425606-1|AAL34513.1|  481|Homo sapiens RNA-binding protein CEL...    42   0.002
AF401233-1|AAK95615.1|  481|Homo sapiens BRUNO-like 6 RNA-bindin...    42   0.002
BC045711-1|AAH45711.1|  448|Homo sapiens BRUNOL4 protein protein.      42   0.002
AF248650-1|AAF86232.1|  294|Homo sapiens RNA-binding protein BRU...    42   0.002
CR457272-1|CAG33553.1|  357|Homo sapiens PSPC1 protein.                41   0.003
BC014184-1|AAH14184.2|  393|Homo sapiens PSPC1 protein protein.        41   0.003
AL354808-5|CAI41005.1|  248|Homo sapiens paraspeckle component 1...    41   0.003
AL354808-4|CAI41004.1|  523|Homo sapiens paraspeckle component 1...    41   0.003
AL136097-15|CAI16208.1|  227|Homo sapiens nucleolar protein 8 pr...    41   0.003
AL136097-14|CAI16209.1|  205|Homo sapiens nucleolar protein 8 pr...    41   0.003
AL136097-13|CAC12712.1|  427|Homo sapiens nucleolar protein 8 pr...    41   0.003
AK001817-1|BAA91924.1|  357|Homo sapiens protein ( Homo sapiens ...    41   0.003
AK001049-1|BAA91479.1|  427|Homo sapiens protein ( Homo sapiens ...    41   0.003
AF449627-1|AAL59602.1|  393|Homo sapiens paraspeckle protein 1 b...    41   0.003
AF448795-1|AAL59601.1|  523|Homo sapiens paraspeckle protein 1 a...    41   0.003
AF031166-1|AAK54351.1|  272|Homo sapiens SRp46 splicing factor p...    41   0.003
AB109030-1|BAC99315.1| 1167|Homo sapiens Nop132 protein.               41   0.003
AB105104-1|BAD12268.1| 1167|Homo sapiens nucleolar protein 8 pro...    41   0.003
U72355-1|AAC00056.1|  915|Homo sapiens Hsp27 ERE-TATA-binding pr...    41   0.004
U51586-1|AAB41656.1|  541|Homo sapiens siah binding protein 1 pr...    41   0.004
M90104-1|AAA60306.1|  221|Homo sapiens splicing factor protein.        41   0.004
L43631-1|AAC18697.1|  864|Homo sapiens scaffold attachment facto...    41   0.004
CR457143-1|CAG33424.1|  559|Homo sapiens SIAHBP1 protein.              41   0.004
BC126219-1|AAI26220.1|  917|Homo sapiens scaffold attachment fac...    41   0.004
BC021715-1|AAH21715.1|  261|Homo sapiens serine-arginine repress...    41   0.004
BC011979-1|AAH11979.1|  516|Homo sapiens SIAHBP1 protein protein.      41   0.004
BC011265-1|AAH11265.1|  516|Homo sapiens SIAHBP1 protein protein.      41   0.004
BC009734-1|AAH09734.1|  499|Homo sapiens SIAHBP1 protein protein.      41   0.004
BC008875-1|AAH08875.1|  542|Homo sapiens fuse-binding protein-in...    41   0.004
BC004167-1|AAH04167.2|  484|Homo sapiens bruno-like 4, RNA bindi...    41   0.004
BC001946-1|AAH01946.2|  484|Homo sapiens bruno-like 4, RNA bindi...    41   0.004
AF449428-1|AAL57515.1|  261|Homo sapiens SRrp35 protein.               41   0.004
AF329265-1|AAK07475.1|  486|Homo sapiens CUG-BP and ETR-3 like f...    41   0.004
AF217197-1|AAF27522.2|  542|Homo sapiens FBP-interacting repress...    41   0.004
AF190744-1|AAF05605.1|  556|Homo sapiens poly-U binding splicing...    41   0.004
AF141345-1|AAG49448.1|  213|Homo sapiens LYST-interacting protei...    41   0.004
AF114818-1|AAF23589.1|  559|Homo sapiens Ro ribonucleoprotein-bi...    41   0.004
AB209774-1|BAD93011.1|  510|Homo sapiens bruno-like 4, RNA bindi...    41   0.004
AB208962-1|BAD92199.1|  358|Homo sapiens PABPC4 protein variant ...    41   0.004
AB208780-1|BAD92017.1|  772|Homo sapiens scaffold attachment fac...    41   0.004
Z95327-4|CAI42681.1|  225|Homo sapiens cleavage stimulation fact...    40   0.005
U89505-1|AAC51293.1|  366|Homo sapiens Hlark protein.                  40   0.005
U77476-1|AAB84361.1|  295|Homo sapiens DAZLA protein protein.          40   0.005
U69546-1|AAB09040.1|  490|Homo sapiens RNA-binding protein BRUNO...    40   0.005
DQ351905-1|ABC73063.1|  595|Homo sapiens heterogeneous nuclear r...    40   0.005
DQ160195-1|AAZ93379.1|  314|Homo sapiens cyclophilin-33B protein.      40   0.005
BC107736-1|AAI07737.1|  301|Homo sapiens peptidylprolyl isomeras...    40   0.005
BC064960-1|AAH64960.1|  143|Homo sapiens RBM4 protein protein.         40   0.005
BC036391-1|AAH36391.1|  521|Homo sapiens CUGBP2 protein protein.       40   0.005
BC032735-1|AAH32735.1|  364|Homo sapiens RNA binding motif prote...    40   0.005
BC021120-1|AAH21120.1|  177|Homo sapiens RBM4 protein protein.         40   0.005
BC008451-1|AAH08451.1|  301|Homo sapiens peptidylprolyl isomeras...    40   0.005
BC006516-1|AAH06516.3|  482|Homo sapiens NCL protein protein.          40   0.005
BC006494-1|AAH06494.3|  482|Homo sapiens NCL protein protein.          40   0.005
BC004951-1|AAH04951.1|  359|Homo sapiens RNA binding motif prote...    40   0.005
BC004898-1|AAH04898.1|  301|Homo sapiens peptidylprolyl isomeras...    40   0.005
BC003503-1|AAH03503.1|  359|Homo sapiens RNA binding motif prote...    40   0.005
BC002343-1|AAH02343.3|  482|Homo sapiens NCL protein protein.          40   0.005
BC000307-1|AAH00307.1|  364|Homo sapiens RNA binding motif prote...    40   0.005
AL157704-2|CAH70230.1|  490|Homo sapiens CUG triplet repeat, RNA...    40   0.005
AL157704-1|CAH70231.1|  498|Homo sapiens CUG triplet repeat, RNA...    40   0.005
AL136320-2|CAI20169.1|  490|Homo sapiens CUG triplet repeat, RNA...    40   0.005
AL136320-1|CAI20168.1|  498|Homo sapiens CUG triplet repeat, RNA...    40   0.005
AL049824-4|CAI19350.1|  301|Homo sapiens peptidylprolyl isomeras...    40   0.005
AL049824-2|CAI19348.1|  296|Homo sapiens peptidylprolyl isomeras...    40   0.005
AL049824-1|CAI19347.1|  314|Homo sapiens peptidylprolyl isomeras...    40   0.005
AL035404-8|CAI19579.1|  301|Homo sapiens peptidylprolyl isomeras...    40   0.005
AL035404-6|CAI19577.1|  296|Homo sapiens peptidylprolyl isomeras...    40   0.005
AL035404-5|CAI19576.1|  314|Homo sapiens peptidylprolyl isomeras...    40   0.005
AL033527-11|CAI19410.1|  296|Homo sapiens peptidylprolyl isomera...    40   0.005
AL033527-10|CAI19409.1|  314|Homo sapiens peptidylprolyl isomera...    40   0.005
AK127608-1|BAC87055.1|  603|Homo sapiens protein ( Homo sapiens ...    40   0.005
AK091742-1|BAC03738.1|  687|Homo sapiens protein ( Homo sapiens ...    40   0.005
AF432906-1|AAL27627.1|  488|Homo sapiens neuroblastoma apoptosis...    40   0.005
AF295068-3|AAK72223.1|  484|Homo sapiens neuroplastoma apoptosis...    40   0.005
AF295068-2|AAK92699.1|  490|Homo sapiens neuroplastoma apoptosis...    40   0.005
AF295068-1|AAK72224.1|  509|Homo sapiens neuroplastoma apoptosis...    40   0.005
AF104013-1|AAD19907.1|  296|Homo sapiens peptidyl-prolyl cis-tra...    40   0.005
AF104012-1|AAD19906.1|  301|Homo sapiens peptidyl-prolyl cis-tra...    40   0.005
AF090694-1|AAD13761.1|  509|Homo sapiens apoptosis-related RNA b...    40   0.005
AF090693-1|AAD13760.1|  508|Homo sapiens apoptosis-related RNA b...    40   0.005
AF042386-1|AAC00007.1|  296|Homo sapiens cyclophilin-33B protein.      40   0.005
AF042385-1|AAC00006.1|  301|Homo sapiens cyclophilin-33A protein.      40   0.005
AF036956-1|AAD02074.1|  490|Homo sapiens neuroblastoma apoptosis...    40   0.005
AC017104-2|AAY24247.1|  710|Homo sapiens unknown protein.              40   0.005
U38175-1|AAB41913.1|  326|Homo sapiens HuR RNA binding protein p...    40   0.007
BT009793-1|AAP88795.1|  326|Homo sapiens ELAV (embryonic lethal,...    40   0.007
BC071575-1|AAH71575.1|   69|Homo sapiens FUSIP1 protein protein.       40   0.007
BC003376-1|AAH03376.1|  326|Homo sapiens ELAV (embryonic lethal,...    40   0.007
U66726-1|AAB39935.1|  295|Homo sapiens germline specific RNA bin...    40   0.009
U66078-1|AAB63596.1|  295|Homo sapiens DAZLA protein.                  40   0.009
U65918-1|AAC50813.1|  295|Homo sapiens RNA binding protein protein.    40   0.009
BC068008-1|AAH68008.1|  407|Homo sapiens TNRC4 protein protein.        40   0.009
BC027595-1|AAH27595.1|  295|Homo sapiens deleted in azoospermia-...    40   0.009
BC010939-1|AAH10939.1|  306|Homo sapiens poly(A) binding protein...    40   0.009
BC004145-1|AAH04145.2|  291|Homo sapiens TNRC4 protein protein.        40   0.009
AL589765-5|CAI17168.1|  465|Homo sapiens trinucleotide repeat co...    40   0.009
AF026029-1|AAC39596.1|  306|Homo sapiens poly(A) binding protein...    40   0.009
U44799-1|AAA86655.1|  246|Homo sapiens U1-snRNP binding protein ...    39   0.011
U44798-1|AAA86654.1|  246|Homo sapiens U1-snRNP binding protein ...    39   0.011
BC111955-1|AAI11956.1|  251|Homo sapiens U11/U12 snRNP 35K, isof...    39   0.011
BC104758-1|AAI04759.1|  465|Homo sapiens trinucleotide repeat co...    39   0.011
BC093671-1|AAH93671.1|  251|Homo sapiens U11/U12 snRNP 35K protein.    39   0.011
BC054034-1|AAH54034.1|  246|Homo sapiens U11/U12 snRNP 35K protein.    39   0.011
BC052491-1|AAH52491.1|  464|Homo sapiens trinucleotide repeat co...    39   0.011
BC047678-1|AAH47678.1|  251|Homo sapiens U11/U12 snRNP 35K protein.    39   0.011
BC009622-1|AAH09622.1|  251|Homo sapiens U11/U12 snRNP 35K protein.    39   0.011
AY165003-1|AAN73884.1|  465|Homo sapiens CUG-BP and ETR-3 like f...    39   0.011
AL589765-4|CAI17167.1|  415|Homo sapiens trinucleotide repeat co...    39   0.011
AL589765-3|CAI17166.1|  465|Homo sapiens trinucleotide repeat co...    39   0.011
AF329264-1|AAK07474.1|  462|Homo sapiens CUG-BP and ETR-3 like f...    39   0.011
AB209264-1|BAD92501.1|  441|Homo sapiens trinucleotide repeat co...    39   0.011
X06815-1|CAA29964.1|  216|Homo sapiens hU1-70K-like protein (216...    39   0.015
M57935-1|AAA36571.1|  166|Homo sapiens ribonucleoprotein antigen...    39   0.015
AF248483-1|AAF91332.1|  413|Homo sapiens deleted in azoospermia ...    39   0.015
X77494-1|CAA54628.1|  389|Homo sapiens MSSP-2 protein.                 38   0.020
X64652-1|CAA45923.1|  372|Homo sapiens 348 aa protein protein.         38   0.020
X04347-1|CAA27874.1|  196|Homo sapiens protein ( Human liver mRN...    38   0.020
U21663-1|AAB02393.1|  366|Homo sapiens DAZ protein protein.            38   0.020
D28482-1|BAA05841.1|  403|Homo sapiens SCR2 protein.                   38   0.020
BC139836-1|AAI39837.1|  563|Homo sapiens RBM15B protein protein.       38   0.020
BC114927-1|AAI14928.1|  613|Homo sapiens DAZ1 protein protein.         38   0.020
BC113006-1|AAI13007.1|  534|Homo sapiens deleted in azoospermia ...    38   0.020
BC113005-1|AAI13006.1|  438|Homo sapiens deleted in azoospermia ...    38   0.020
BC047617-1|AAH47617.1|  390|Homo sapiens deleted in azoospermia ...    38   0.020
BC047480-1|AAH47480.1|  390|Homo sapiens deleted in azoospermia ...    38   0.020
BC018951-1|AAH18951.1|  406|Homo sapiens RNA binding motif, sing...    38   0.020
BC012993-1|AAH12993.1|  403|Homo sapiens RNA binding motif, sing...    38   0.020
BC012992-1|AAH12992.1|  403|Homo sapiens RNA binding motif, sing...    38   0.020
AF414184-1|AAL24502.1|  534|Homo sapiens deleted in azoospermia ...    38   0.020
AF271088-1|AAF91406.1|  501|Homo sapiens deleted in azoospermia ...    38   0.020
AF271087-1|AAF91405.1|  458|Homo sapiens deleted in azoospermia ...    38   0.020
AF248482-1|AAF91331.1|  331|Homo sapiens deleted in azoospermia ...    38   0.020
AF248481-1|AAF91330.1|  486|Homo sapiens deleted in azoospermia ...    38   0.020
AF248480-1|AAF91329.1|  558|Homo sapiens deleted in azoospermia ...    38   0.020
AC104598-1|AAX93183.1|  188|Homo sapiens unknown protein.              38   0.020
L35013-1|AAA60300.1|  424|Homo sapiens spliceosomal protein prot...    38   0.026
D82351-1|BAA11561.1|  373|Homo sapiens MSSP-1 protein.                 38   0.026
D28483-1|BAA05842.1|  407|Homo sapiens SCR3 protein.                   38   0.026
BX537536-1|CAD97776.1|  492|Homo sapiens hypothetical protein pr...    38   0.026
BC107684-1|AAI07685.1|  387|Homo sapiens PPIL4 protein protein.        38   0.026
BC090883-1|AAH90883.1|  424|Homo sapiens splicing factor 3b, sub...    38   0.026
BC072679-1|AAH72679.1|  407|Homo sapiens RNA binding motif, sing...    38   0.026
BC064134-1|AAH64134.1|  434|Homo sapiens PPIL4 protein protein.        38   0.026
BC027863-1|AAH27863.1|  407|Homo sapiens RNA binding motif, sing...    38   0.026
BC020986-1|AAH20986.1|  492|Homo sapiens peptidylprolyl isomeras...    38   0.026
BC014944-1|AAH14944.1|  672|Homo sapiens SLTM protein protein.         38   0.026
BC013886-1|AAH13886.1|  424|Homo sapiens splicing factor 3b, sub...    38   0.026
BC004273-1|AAH04273.1|  424|Homo sapiens splicing factor 3b, sub...    38   0.026
AL591493-2|CAI12554.1|  424|Homo sapiens splicing factor 3b, sub...    38   0.026

>AF181719-1|AAF78364.1|  407|Homo sapiens DAZ associated protein 1
           protein.
          Length = 407

 Score =  143 bits (347), Expect = 4e-34
 Identities = 70/128 (54%), Positives = 87/128 (67%), Gaps = 13/128 (10%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE GKLFVGGL W T+QE L+ YFS+YGEV+DCV+MK+  + +SRGFGFV F DP+ V  
Sbjct: 7   DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGT 66

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQ----KPKRG------GGYP---KVFLGGLPSNVTE 397
           VL + PH LDGR IDPKPC PR +Q    +PK G        Y    K+F+GG+P N  E
Sbjct: 67  VLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDYSKSNKIFVGGIPHNCGE 126

Query: 398 TDLRXIFR 421
           T+LR  F+
Sbjct: 127 TELREYFK 134



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/92 (32%), Positives = 50/92 (54%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G +  P  D  +  K+FVGG+     +  L+ YF ++G V + V++ ++E  R RGFGF+
Sbjct: 100 GWQKGPRSDYSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFI 159

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
           TF D   V+  +    H + G+ ++ K   PR
Sbjct: 160 TFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 18/39 (46%), Positives = 28/39 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QS 530
           +F ++G V EVV++YD  K++  G GF++FEDE S  Q+
Sbjct: 132 YFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 170



 Score = 37.1 bits (82), Expect = 0.046
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YG+V++ VIM D+   +S G GF+ F+D
Sbjct: 29  YFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD 60


>BC012062-1|AAH12062.1|  407|Homo sapiens DAZ associated protein 1
           protein.
          Length = 407

 Score =  142 bits (345), Expect = 6e-34
 Identities = 69/128 (53%), Positives = 86/128 (67%), Gaps = 13/128 (10%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE GKLFVGGL W T+QE L+ YFS+YGEV+DCV+MK+  + +SRGFGFV F DP+ V  
Sbjct: 7   DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGT 66

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQ----KPKRG---------GGYPKVFLGGLPSNVTE 397
           VL + PH LDGR IDPKPC PR +Q    +PK G             K+F+GG+P N  E
Sbjct: 67  VLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGE 126

Query: 398 TDLRXIFR 421
           T+LR  F+
Sbjct: 127 TELREYFK 134



 Score = 69.3 bits (162), Expect = 9e-12
 Identities = 30/92 (32%), Positives = 51/92 (55%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G +  P  D+ +  K+FVGG+     +  L+ YF ++G V + V++ ++E  R RGFGF+
Sbjct: 100 GWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFI 159

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
           TF D   V+  +    H + G+ ++ K   PR
Sbjct: 160 TFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 18/39 (46%), Positives = 28/39 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QS 530
           +F ++G V EVV++YD  K++  G GF++FEDE S  Q+
Sbjct: 132 YFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 170



 Score = 37.1 bits (82), Expect = 0.046
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YG+V++ VIM D+   +S G GF+ F+D
Sbjct: 29  YFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD 60


>AY678451-1|AAV97647.1|  454|Homo sapiens DAZAP1/MEF2D fusion
           protein protein.
          Length = 454

 Score =  142 bits (345), Expect = 6e-34
 Identities = 69/128 (53%), Positives = 86/128 (67%), Gaps = 13/128 (10%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           DE GKLFVGGL W T+QE L+ YFS+YGEV+DCV+MK+  + +SRGFGFV F DP+ V  
Sbjct: 7   DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGT 66

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQ----KPKRG---------GGYPKVFLGGLPSNVTE 397
           VL + PH LDGR IDPKPC PR +Q    +PK G             K+F+GG+P N  E
Sbjct: 67  VLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGE 126

Query: 398 TDLRXIFR 421
           T+LR  F+
Sbjct: 127 TELREYFK 134



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G +  P  D+ +  K+FVGG+     +  L+ YF ++G V + V++ ++E  R RG G+V
Sbjct: 100 GWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGNGYV 159

Query: 227 TF-ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKR 343
           +  A P L+ +   N  +++      P P +   L  P R
Sbjct: 160 SARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSR 199



 Score = 37.1 bits (82), Expect = 0.046
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YG+V++ VIM D+   +S G GF+ F+D
Sbjct: 29  YFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD 60



 Score = 32.3 bits (70), Expect = 1.3
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLS 500
           +F ++G V EVV++YD  K++  G G++S
Sbjct: 132 YFKKFGVVTEVVMIYDAEKQRPRGNGYVS 160


>BC001526-1|AAH01526.1|  328|Homo sapiens musashi homolog 2
           (Drosophila) protein.
          Length = 328

 Score =  122 bits (294), Expect = 9e-28
 Identities = 56/113 (49%), Positives = 80/113 (70%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GK+F+GGLSW+TS ++L+ YFS++GE+ +C+VM++  + RSRGFGFVTFADP+ V+ V
Sbjct: 19  DPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKV 78

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           L    H+LD +TIDPK   PR  Q PK      K+F+GGL +N    D++  F
Sbjct: 79  LGQPHHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSANTVVEDVKQYF 130



 Score = 68.9 bits (161), Expect = 1e-11
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T  E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 100 RAQPKMVTRTK-KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTF 158

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
            +  +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 159 ENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFP 193



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 12/33 (36%), Positives = 24/33 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE+E
Sbjct: 129 YFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENE 161


>AK093888-1|BAC04244.1|  251|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36569 fis, clone TRACH2010824, highly similar to
           Ribonucleoprotein. ).
          Length = 251

 Score =  119 bits (287), Expect = 7e-27
 Identities = 55/110 (50%), Positives = 78/110 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGLSW+TS ++L+ YFS++GE+ +C+VM++  + RSRGFGFVTFADP+ V+ VL  
Sbjct: 18  KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQ 77

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             H+LD +TIDPK   PR  Q PK      K+F+GGL +N    D++  F
Sbjct: 78  PHHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSANTVVEDVKQYF 126



 Score = 68.9 bits (161), Expect = 1e-11
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T  E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 96  RAQPKMVTRTK-KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTF 154

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
            +  +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 155 ENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFP 189



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 12/33 (36%), Positives = 24/33 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE+E
Sbjct: 125 YFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENE 157


>AC003982-3|AAB95636.1|  362|Homo sapiens WUGSC:H_166H1.2 protein.
          Length = 362

 Score =  116 bits (280), Expect = 5e-26
 Identities = 58/120 (48%), Positives = 79/120 (65%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +PD   D   K+F+GGLSW+T+QE L+ YF ++GEV +C+VM++  + RSRGFGFVTF D
Sbjct: 12  SPDSPHDPC-KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD 70

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            + V+ VL    H+LD +TIDPK   PR  Q PK      K+F+GGL  N T  D++  F
Sbjct: 71  QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSVNTTVEDVKQYF 129



 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T+ E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 99  RAQPKMVTRTK-KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 157

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 158 ESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSP 192



 Score = 37.9 bits (84), Expect = 0.026
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +FG++G+V E ++M D   K+S G GF++F D+
Sbjct: 39  YFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQ 71



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE E
Sbjct: 128 YFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESE 160


>AB012851-1|BAA33962.1|  362|Homo sapiens Musashi protein.
          Length = 362

 Score =  116 bits (280), Expect = 5e-26
 Identities = 58/120 (48%), Positives = 79/120 (65%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +PD   D   K+F+GGLSW+T+QE L+ YF ++GEV +C+VM++  + RSRGFGFVTF D
Sbjct: 12  SPDSPHDPC-KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD 70

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            + V+ VL    H+LD +TIDPK   PR  Q PK      K+F+GGL  N T  D++  F
Sbjct: 71  QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSVNTTVEDVKQYF 129



 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T+ E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 99  RAQPKMVTRTK-KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 157

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 158 ESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSP 192



 Score = 37.9 bits (84), Expect = 0.026
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +FG++G+V E ++M D   K+S G GF++F D+
Sbjct: 39  YFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQ 71



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE E
Sbjct: 128 YFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESE 160


>BC036708-1|AAH36708.1|  332|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 332

 Score =  114 bits (274), Expect = 3e-25
 Identities = 53/124 (42%), Positives = 78/124 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+
Sbjct: 57  GDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFI 116

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VL    H+LDGR IDPK          K      K+F+GGL    TE  +
Sbjct: 117 LFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPEATEEKI 170

Query: 407 RXIF 418
           R  F
Sbjct: 171 REYF 174



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D   K+FVGGL+ E ++E ++ YF  +GE+    +  + +  + RGF F+TF +   
Sbjct: 148 MKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEP 207

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
           V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 208 VKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 243



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 89  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 123


>BC009359-1|AAH09359.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score =  114 bits (274), Expect = 3e-25
 Identities = 53/124 (42%), Positives = 78/124 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+
Sbjct: 57  GDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFI 116

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VL    H+LDGR IDPK          K      K+F+GGL    TE  +
Sbjct: 117 LFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPEATEEKI 170

Query: 407 RXIF 418
           R  F
Sbjct: 171 REYF 174



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D   K+FVGGL+ E ++E ++ YF  +GE+    +  + +  + RGF F+TF +   
Sbjct: 148 MKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEP 207

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
           V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 208 VKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 243



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 89  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 123


>BC004561-1|AAH04561.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score =  114 bits (274), Expect = 3e-25
 Identities = 53/124 (42%), Positives = 78/124 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+
Sbjct: 57  GDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFI 116

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VL    H+LDGR IDPK          K      K+F+GGL    TE  +
Sbjct: 117 LFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPEATEEKI 170

Query: 407 RXIF 418
           R  F
Sbjct: 171 REYF 174



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D   K+FVGGL+ E ++E ++ YF  +GE+    +  + +  + RGF F+TF +   
Sbjct: 148 MKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEP 207

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
           V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 208 VKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 243



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 89  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 123


>BC002625-1|AAH02625.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score =  114 bits (274), Expect = 3e-25
 Identities = 53/124 (42%), Positives = 78/124 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+
Sbjct: 57  GDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFI 116

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VL    H+LDGR IDPK          K      K+F+GGL    TE  +
Sbjct: 117 LFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPEATEEKI 170

Query: 407 RXIF 418
           R  F
Sbjct: 171 REYF 174



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D   K+FVGGL+ E ++E ++ YF  +GE+    +  + +  + RGF F+TF +   
Sbjct: 148 MKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEP 207

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
           V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 208 VKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 243



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 89  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 123


>BC001616-1|AAH01616.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score =  114 bits (274), Expect = 3e-25
 Identities = 53/124 (42%), Positives = 78/124 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+
Sbjct: 57  GDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFI 116

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VL    H+LDGR IDPK          K      K+F+GGL    TE  +
Sbjct: 117 LFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPEATEEKI 170

Query: 407 RXIF 418
           R  F
Sbjct: 171 REYF 174



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D   K+FVGGL+ E ++E ++ YF  +GE+    +  + +  + RGF F+TF +   
Sbjct: 148 MKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEP 207

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
           V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 208 VKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 243



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 89  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 123


>AK223425-1|BAD97145.1|  332|Homo sapiens heterogeneous nuclear
           ribonucleoprotein AB isoform a variant protein.
          Length = 332

 Score =  114 bits (274), Expect = 3e-25
 Identities = 53/124 (42%), Positives = 78/124 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+
Sbjct: 57  GDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFI 116

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VL    H+LDGR IDPK          K      K+F+GGL    TE  +
Sbjct: 117 LFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPEATEEKI 170

Query: 407 RXIF 418
           R  F
Sbjct: 171 REYF 174



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D   K+FVGGL+ E ++E ++ YF  +GE+    +  + +  + RGF F+TF +   
Sbjct: 148 MKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEP 207

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
           V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 208 VKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 243



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 89  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 123


>AK097657-1|BAC05134.1|  332|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40338 fis, clone TESTI2032067, highly similar to
           Rattus norvegicus mRNA for type A/B hnRNP protein p40.
           ).
          Length = 332

 Score =  114 bits (274), Expect = 3e-25
 Identities = 53/124 (42%), Positives = 78/124 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+
Sbjct: 57  GDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFI 116

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V  VL    H+LDGR IDPK          K      K+F+GGL    TE  +
Sbjct: 117 LFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPEATEEKI 170

Query: 407 RXIF 418
           R  F
Sbjct: 171 REYF 174



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M  D   K+FVGGL+ E ++E ++ YF  +GE+    +  + +  + RGF F+TF +   
Sbjct: 148 MKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEP 207

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
           V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 208 VKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 243



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 89  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 123


>D89092-1|BAA24361.1|  301|Homo sapiens hnRNP JKTBP protein.
          Length = 301

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 16  GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 75

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 76  LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 130

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 131 KEYFGAFGE 139



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 115 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 174

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 175 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 205



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 48  YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 82


>CR407623-1|CAG28551.1|  420|Homo sapiens HNRPDL protein.
          Length = 420

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 135 GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 194

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 195 LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 249

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 250 KEYFGAFGE 258



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 234 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 293

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 294 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 324



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 167 YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 201


>BC071944-1|AAH71944.1|  420|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D-like protein.
          Length = 420

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 135 GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 194

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 195 LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 249

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 250 KEYFGAFGE 258



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 234 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 293

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 294 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 324



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 167 YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 201


>BC011714-1|AAH11714.1|  420|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D-like protein.
          Length = 420

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 135 GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 194

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 195 LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 249

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 250 KEYFGAFGE 258



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 234 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 293

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 294 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 324



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 167 YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 201


>BC007392-1|AAH07392.2|  415|Homo sapiens HNRPDL protein protein.
          Length = 415

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 130 GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 189

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 190 LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 244

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 245 KEYFGAFGE 253



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 229 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 288

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 289 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 319



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 162 YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 196


>AY453824-1|AAR17782.1|  298|Homo sapiens CArG binding factor
           protein.
          Length = 298

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 13  GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 72

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 73  LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 127

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 128 KEYFGAFGE 136



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 112 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 171

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 172 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 202



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 45  YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 79


>AC124016-2|AAY40914.1|  420|Homo sapiens unknown protein.
          Length = 420

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 135 GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 194

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 195 LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 249

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 250 KEYFGAFGE 258



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 234 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 293

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 294 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 324



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 167 YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 201


>AB066484-1|BAB62188.1|  244|Homo sapiens JKTBP1delta6 protein.
          Length = 244

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 16  GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 75

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 76  LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 130

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 131 KEYFGAFGE 139



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 115 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 174

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 175 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 205



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 48  YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 82


>AB017019-1|BAA75241.1|  420|Homo sapiens JKTBP2 protein.
          Length = 420

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 135 GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 194

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 195 LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 249

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 250 KEYFGAFGE 258



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 234 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 293

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 294 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 324



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 167 YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 201


>AB017018-2|BAA75240.1|  301|Homo sapiens JKTBP1 protein.
          Length = 301

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 16  GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 75

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 76  LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 130

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 131 KEYFGAFGE 139



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 115 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 174

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 175 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 205



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 48  YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 82


>AB017018-1|BAA75239.1|  420|Homo sapiens JKTBP2 protein.
          Length = 420

 Score =  113 bits (273), Expect = 3e-25
 Identities = 53/129 (41%), Positives = 81/129 (62%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G ++N   +  + GK+F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV
Sbjct: 135 GSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFV 194

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F D + V+ VL+   H+LDG+ IDPK       ++P +     KVF+GGL  + +E  +
Sbjct: 195 LFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQI 249

Query: 407 RXIFRTLWE 433
           +  F    E
Sbjct: 250 KEYFGAFGE 258



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 234 KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 293

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 294 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 324



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 167 YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 201


>U76713-1|AAC50956.1|  331|Homo sapiens ABBP-1 protein.
          Length = 331

 Score =  112 bits (269), Expect = 1e-24
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 1/123 (0%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+ F
Sbjct: 57  QINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILF 116

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL-PSNVTETDLR 409
            D + V  VL    H+LDGR IDPK          K      K+F+GGL P + TE  +R
Sbjct: 117 KDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPESPTEEKIR 170

Query: 410 XIF 418
             F
Sbjct: 171 EYF 173



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWET-SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           M  D   K+FVGGL+ E+ ++E ++ YF  +GE+    +  + +  + RGF F+TF +  
Sbjct: 146 MKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEE 205

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
            V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 206 PVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 242



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 87  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 121


>M65028-1|AAA36575.1|  284|Homo sapiens hnRNP type A/B protein
           protein.
          Length = 284

 Score =  112 bits (269), Expect = 1e-24
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 1/123 (0%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++N   ++++ GK+FVGGLSW+TS+++L+ YF+++GEV+DC +  +  +GRSRGFGF+ F
Sbjct: 57  QINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILF 116

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL-PSNVTETDLR 409
            D + V  VL    H+LDGR IDPK          K      K+F+GGL P + TE  +R
Sbjct: 117 KDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVK------KIFVGGLNPESPTEEKIR 170

Query: 410 XIF 418
             F
Sbjct: 171 EYF 173



 Score = 54.0 bits (124), Expect = 4e-07
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWET-SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           M  D   K+FVGGL+ E+ ++E ++ YF  +GE+    +  + +  + RGF F+TF +  
Sbjct: 146 MKKDPVKKIFVGGLNPESPTEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEE 205

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTL-QKPKRGGG 352
            V  VL+   H + G   + K   P+ + Q+ + G G
Sbjct: 206 PVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG 242



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++G+V++  I  D    +S G GF+ F+D  S
Sbjct: 87  YFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAAS 121


>U02019-1|AAC50056.1|  286|Homo sapiens p37 AUF1 protein.
          Length = 286

 Score =  109 bits (262), Expect = 7e-24
 Identities = 52/153 (33%), Positives = 91/153 (59%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G +++   +++++GK+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV
Sbjct: 63  GAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFV 122

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F +   V+ V+    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +
Sbjct: 123 LFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKI 177

Query: 407 RXIFRTLWEGHGGGHYV*SXEEKVXGFXILVFR 505
           R  F    E       + +   K  GF  + F+
Sbjct: 178 REYFGGFGEVESIELPMDNKTNKRRGFCFITFK 210



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 162 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 221

Query: 269 GPHQL 283
             H +
Sbjct: 222 KYHNV 226


>AF026126-3|AAC23476.1|  336|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 336

 Score =  109 bits (262), Expect = 7e-24
 Identities = 52/153 (33%), Positives = 91/153 (59%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G +++   +++++GK+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV
Sbjct: 65  GAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFV 124

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            F +   V+ V+    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +
Sbjct: 125 LFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKI 179

Query: 407 RXIFRTLWEGHGGGHYV*SXEEKVXGFXILVFR 505
           R  F    E       + +   K  GF  + F+
Sbjct: 180 REYFGGFGEVESIELPMDNKTNKRRGFCFITFK 212



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 164 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 223

Query: 269 GPHQL 283
             H +
Sbjct: 224 KYHNV 228


>D55671-1|BAA09522.1|  267|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 267

 Score =  106 bits (255), Expect = 5e-23
 Identities = 51/145 (35%), Positives = 87/145 (60%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           +++++GK+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V
Sbjct: 4   NEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESV 63

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLW 430
           + V+    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    
Sbjct: 64  DKVMDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFG 118

Query: 431 EGHGGGHYV*SXEEKVXGFXILVFR 505
           E       + +   K  GF  + F+
Sbjct: 119 EVESIELPMDNKTNKRRGFCFITFK 143



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 95  KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 154

Query: 269 GPHQL 283
             H +
Sbjct: 155 KYHNV 159


>D89678-1|BAA22860.1|  271|Homo sapiens A+U-rich element RNA binding
           factor protein.
          Length = 271

 Score =  103 bits (248), Expect = 4e-22
 Identities = 49/114 (42%), Positives = 73/114 (64%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           +F+GGLSW+TS+++L  Y SR+GEV+DC +  +  +GRSRGFGFV F D + V+ VL+  
Sbjct: 1   MFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELK 60

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
            H+LDG+ IDPK       ++P +     KVF+GGL  + +E  ++  F    E
Sbjct: 61  EHKLDGKLIDPKRAKALKGKEPPK-----KVFVGGLSPDTSEEQIKEYFGAFGE 109



 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 30/91 (32%), Positives = 53/91 (58%), Gaps = 4/91 (4%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +TS+E ++ YF  +GE+ +  +  ++++   RGF F+T+ D   V  +L++
Sbjct: 85  KVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLES 144

Query: 269 GPHQLDGRTIDPKPCNP----RTLQKPKRGG 349
             HQ+     + K   P    R  Q+ ++GG
Sbjct: 145 RYHQIGSGKCEIKVAQPKEVYRQQQQQQKGG 175



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +  R+G+V++  I  D    +S G GF+ F+D  S
Sbjct: 18  YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAAS 52


>D55674-1|BAA09525.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 355

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>D55673-1|BAA09524.1|  215|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 215

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 4   EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 63

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 64  MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 118

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 119 SIELPMDNKTNKRRGFCFITFK 140



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 92  KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 151

Query: 269 GPHQL 283
             H +
Sbjct: 152 KYHNV 156


>D55672-1|BAA09523.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 306

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>BC026015-1|AAH26015.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 306

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>BC023977-1|AAH23977.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 306

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>BC002401-1|AAH02401.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 355

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>AF039575-1|AAB96683.1|  298|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D0B protein.
          Length = 298

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 87  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 146

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 147 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 201

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 202 SIELPMDNKTNKRRGFCFITFK 223



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 175 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 234

Query: 269 GPHQL 283
             H +
Sbjct: 235 KYHNV 239


>AF026126-2|AAC23475.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 306

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>AF026126-1|AAC23474.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 355

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>AC124016-1|AAY40913.1|  355|Homo sapiens unknown protein.
          Length = 355

 Score =  102 bits (245), Expect = 8e-22
 Identities = 51/142 (35%), Positives = 83/142 (58%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 95  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 154

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEGH 439
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F    E  
Sbjct: 155 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYFGGFGEVE 209

Query: 440 GGGHYV*SXEEKVXGFXILVFR 505
                + +   K  GF  + F+
Sbjct: 210 SIELPMDNKTNKRRGFCFITFK 231



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/65 (33%), Positives = 40/65 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF +   V  +++ 
Sbjct: 183 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK 242

Query: 269 GPHQL 283
             H +
Sbjct: 243 KYHNV 247


>M94630-1|AAA35781.1|  328|Homo sapiens DNA-binding protein protein.
          Length = 328

 Score =  102 bits (244), Expect = 1e-21
 Identities = 46/113 (40%), Positives = 74/113 (65%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+ K+F+GGLSW+T++++L+ YFS++GEV+DC +  +  +GRSRGFGFV F +   V+ V
Sbjct: 74  EEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV 133

Query: 260 LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +    H+L+G+ IDPK       ++P +     K+F+GGL  +  E  +R  F
Sbjct: 134 MDQKEHKLNGKVIDPKRAKAMKTKEPVK-----KIFVGGLSPDTPEEKIREYF 181



 Score = 49.6 bits (113), Expect = 8e-06
 Identities = 21/65 (32%), Positives = 39/65 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RG  F+TF +   V  +++ 
Sbjct: 162 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGLCFITFKEEEPVKKIMEK 221

Query: 269 GPHQL 283
             H +
Sbjct: 222 KYHNV 226


>U09123-1|AAB60650.1|  341|Homo sapiens hnRNP protein A2 protein.
          Length = 341

 Score =  101 bits (242), Expect = 2e-21
 Identities = 48/119 (40%), Positives = 76/119 (63%), Gaps = 1/119 (0%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           + + ++  KLF+GGLS+ET++E+L+ Y+ ++G++ DCVVM++  S RSRGFGFVTF+  +
Sbjct: 2   EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMA 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            V+  +   PH +DGR ++PK    R    KP       K+F+GG+  +  E  LR  F
Sbjct: 62  EVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYF 120



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 26/71 (36%), Positives = 44/71 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGG+  +T + +L+ YF  YG++    ++ + +SG+ RGFGFVTF D   V+ ++  
Sbjct: 101 KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQ 160

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 161 KYHTINGHNAE 171



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/30 (36%), Positives = 21/30 (70%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           ++ ++GK+ + V+M D   K+S G GF++F
Sbjct: 28  YYEQWGKLTDCVVMRDPASKRSRGFGFVTF 57



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YGK+  + I+ D+   K  G GF++F+D
Sbjct: 119 YFEEYGKIDTIEIITDRQSGKKRGFGFVTFDD 150


>M29065-1|AAA36574.1|  341|Homo sapiens protein ( Human hnRNP A2
           protein mRNA. ).
          Length = 341

 Score =  101 bits (242), Expect = 2e-21
 Identities = 48/119 (40%), Positives = 76/119 (63%), Gaps = 1/119 (0%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           + + ++  KLF+GGLS+ET++E+L+ Y+ ++G++ DCVVM++  S RSRGFGFVTF+  +
Sbjct: 2   EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMA 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            V+  +   PH +DGR ++PK    R    KP       K+F+GG+  +  E  LR  F
Sbjct: 62  EVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYF 120



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 26/71 (36%), Positives = 44/71 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGG+  +T + +L+ YF  YG++    ++ + +SG+ RGFGFVTF D   V+ ++  
Sbjct: 101 KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQ 160

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 161 KYHTINGHNAE 171



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/30 (36%), Positives = 21/30 (70%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           ++ ++GK+ + V+M D   K+S G GF++F
Sbjct: 28  YYEQWGKLTDCVVMRDPASKRSRGFGFVTF 57



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YGK+  + I+ D+   K  G GF++F+D
Sbjct: 119 YFEEYGKIDTIEIITDRQSGKKRGFGFVTFDD 150


>D28877-2|BAA06032.1|  341|Homo sapiens hnRNP A2 protein protein.
          Length = 341

 Score =  101 bits (242), Expect = 2e-21
 Identities = 48/119 (40%), Positives = 76/119 (63%), Gaps = 1/119 (0%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           + + ++  KLF+GGLS+ET++E+L+ Y+ ++G++ DCVVM++  S RSRGFGFVTF+  +
Sbjct: 2   EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMA 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            V+  +   PH +DGR ++PK    R    KP       K+F+GG+  +  E  LR  F
Sbjct: 62  EVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYF 120



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 26/71 (36%), Positives = 44/71 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGG+  +T + +L+ YF  YG++    ++ + +SG+ RGFGFVTF D   V+ ++  
Sbjct: 101 KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQ 160

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 161 KYHTINGHNAE 171



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/30 (36%), Positives = 21/30 (70%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           ++ ++GK+ + V+M D   K+S G GF++F
Sbjct: 28  YYEQWGKLTDCVVMRDPASKRSRGFGFVTF 57



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YGK+  + I+ D+   K  G GF++F+D
Sbjct: 119 YFEEYGKIDTIEIITDRQSGKKRGFGFVTFDD 150


>BC000506-1|AAH00506.3|  249|Homo sapiens HNRPA2B1 protein protein.
          Length = 249

 Score =  101 bits (242), Expect = 2e-21
 Identities = 48/119 (40%), Positives = 76/119 (63%), Gaps = 1/119 (0%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           + + ++  KLF+GGLS+ET++E+L+ Y+ ++G++ DCVVM++  S RSRGFGFVTF+  +
Sbjct: 2   EREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMA 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            V+  +   PH +DGR ++PK    R    KP       K+F+GG+  +  E  LR  F
Sbjct: 62  EVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYF 120



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 26/71 (36%), Positives = 44/71 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGG+  +T + +L+ YF  YG++    ++ + +SG+ RGFGFVTF D   V+ ++  
Sbjct: 101 KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQ 160

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 161 KYHTINGHNAE 171



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/30 (36%), Positives = 21/30 (70%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           ++ ++GK+ + V+M D   K+S G GF++F
Sbjct: 28  YYEQWGKLTDCVVMRDPASKRSRGFGFVTF 57



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YGK+  + I+ D+   K  G GF++F+D
Sbjct: 119 YFEEYGKIDTIEIITDRQSGKKRGFGFVTFDD 150


>M29064-1|AAA60271.1|  353|Homo sapiens SNRPB1 protein.
          Length = 353

 Score =  101 bits (241), Expect = 2e-21
 Identities = 48/111 (43%), Positives = 72/111 (64%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGLS+ET++E+L+ Y+ ++G++ DCVVM++  S RSRGFGFVTF+  + V+  +  
Sbjct: 22  KLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA 81

Query: 269 GPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            PH +DGR ++PK    R    KP       K+F+GG+  +  E  LR  F
Sbjct: 82  RPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYF 132



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 26/71 (36%), Positives = 44/71 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGG+  +T + +L+ YF  YG++    ++ + +SG+ RGFGFVTF D   V+ ++  
Sbjct: 113 KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQ 172

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 173 KYHTINGHNAE 183



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/30 (36%), Positives = 21/30 (70%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           ++ ++GK+ + V+M D   K+S G GF++F
Sbjct: 40  YYEQWGKLTDCVVMRDPASKRSRGFGFVTF 69



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YGK+  + I+ D+   K  G GF++F+D
Sbjct: 131 YFEEYGKIDTIEIITDRQSGKKRGFGFVTFDD 162


>D28877-1|BAA06031.1|  353|Homo sapiens hnRNP B1 protein protein.
          Length = 353

 Score =  101 bits (241), Expect = 2e-21
 Identities = 48/111 (43%), Positives = 72/111 (64%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGLS+ET++E+L+ Y+ ++G++ DCVVM++  S RSRGFGFVTF+  + V+  +  
Sbjct: 22  KLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAA 81

Query: 269 GPHQLDGRTIDPKPCNPRTLQ-KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            PH +DGR ++PK    R    KP       K+F+GG+  +  E  LR  F
Sbjct: 82  RPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYF 132



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 26/71 (36%), Positives = 44/71 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGG+  +T + +L+ YF  YG++    ++ + +SG+ RGFGFVTF D   V+ ++  
Sbjct: 113 KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQ 172

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 173 KYHTINGHNAE 183



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/30 (36%), Positives = 21/30 (70%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           ++ ++GK+ + V+M D   K+S G GF++F
Sbjct: 40  YYEQWGKLTDCVVMRDPASKRSRGFGFVTF 69



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F  YGK+  + I+ D+   K  G GF++F+D
Sbjct: 131 YFEEYGKIDTIEIITDRQSGKKRGFGFVTFDD 162


>BC108266-1|AAI08267.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1-like protein.
          Length = 320

 Score =   99 bits (238), Expect = 6e-21
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNTTPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H + G   + +   P+
Sbjct: 166 KYHTVKGHNCEVRKALPK 183



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>AL137058-3|CAI16736.1|  320|Homo sapiens protein ( Human DNA
           sequence from clone RP11-78J21 on chromosome
           13q32.2-33.3 Contains 2 novel genes, a pseudogene
           similar to part of TPTE and  ).
          Length = 320

 Score =   99 bits (238), Expect = 6e-21
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNTTPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTIDPKPCNPR 322
             H + G   + +   P+
Sbjct: 166 KYHTVKGHNCEVRKALPK 183



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>X79536-1|CAA56072.1|  320|Homo sapiens hnRNPcore protein A1
           protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>X12671-1|CAA31191.1|  320|Homo sapiens hnrnp a1 protein protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>X06747-1|CAA29922.1|  320|Homo sapiens protein ( Human hnRNP core
           protein A1. ).
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 54.8 bits (126), Expect = 2e-07
 Identities = 23/71 (32%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF ++G++    +M +  SG+ +GF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQFGKIEVIEIMTDRGSGKKKGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++GK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQFGKIEVIEIMTDRGSGKKKGFAFVTFDDHDS 158


>BC121133-1|AAI21134.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC103707-1|AAI03708.1|  267|Homo sapiens HNRPA1 protein protein.
          Length = 267

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC074502-1|AAH74502.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC073162-1|AAH73162.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC071945-1|AAH71945.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 56.0 bits (129), Expect = 9e-08
 Identities = 24/71 (33%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF ++G++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQFGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F ++GK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQFGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC070315-1|AAH70315.1|  320|Homo sapiens HNRPA1 protein protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC052296-1|AAH52296.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC033714-1|AAH33714.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC012158-1|AAH12158.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC009600-1|AAH09600.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC002355-1|AAH02355.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 47/117 (40%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V
Sbjct: 9   EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEV 68

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 69  DAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 125



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 106 KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 165

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 166 KYHTVNGHNCE 176



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 124 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 158


>BC113470-1|AAI13471.1|  378|Homo sapiens LOC653115 protein protein.
          Length = 378

 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 45/117 (38%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ ++L+ +F ++G + DCVVM++ ++ RSRGFGFVT++    V
Sbjct: 30  EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEV 89

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R    KP       K+F+GG+  +  E +LR  F
Sbjct: 90  DAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYF 146



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 28/73 (38%), Positives = 46/73 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + NL+ YF +YG++    VM++ +SG+ RGF FVTF D   V+ ++  
Sbjct: 127 KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQ 186

Query: 269 GPHQLDGRTIDPK 307
             H ++G   + K
Sbjct: 187 KYHTINGHNCEVK 199



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YGK+  + +M D+   K  G  F++F+D
Sbjct: 145 YFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176


>BC112027-1|AAI12028.1|  378|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A3 protein.
          Length = 378

 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 45/117 (38%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ ++L+ +F ++G + DCVVM++ ++ RSRGFGFVT++    V
Sbjct: 30  EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEV 89

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R    KP       K+F+GG+  +  E +LR  F
Sbjct: 90  DAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYF 146



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 28/73 (38%), Positives = 46/73 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + NL+ YF +YG++    VM++ +SG+ RGF FVTF D   V+ ++  
Sbjct: 127 KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQ 186

Query: 269 GPHQLDGRTIDPK 307
             H ++G   + K
Sbjct: 187 KYHTINGHNCEVK 199



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YGK+  + +M D+   K  G  F++F+D
Sbjct: 145 YFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176


>AY363225-1|AAQ63629.1|  378|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A3 protein.
          Length = 378

 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 45/117 (38%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ ++L+ +F ++G + DCVVM++ ++ RSRGFGFVT++    V
Sbjct: 30  EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEV 89

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R    KP       K+F+GG+  +  E +LR  F
Sbjct: 90  DAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYF 146



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 28/73 (38%), Positives = 46/73 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + NL+ YF +YG++    VM++ +SG+ RGF FVTF D   V+ ++  
Sbjct: 127 KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQ 186

Query: 269 GPHQLDGRTIDPK 307
             H ++G   + K
Sbjct: 187 KYHTINGHNCEVK 199



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YGK+  + +M D+   K  G  F++F+D
Sbjct: 145 YFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176


>AC079305-1|AAY14709.1|  378|Homo sapiens unknown protein.
          Length = 378

 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 45/117 (38%), Positives = 75/117 (64%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ ++L+ +F ++G + DCVVM++ ++ RSRGFGFVT++    V
Sbjct: 30  EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEV 89

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   PH++DGR ++PK    R    KP       K+F+GG+  +  E +LR  F
Sbjct: 90  DAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYF 146



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 28/73 (38%), Positives = 46/73 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + NL+ YF +YG++    VM++ +SG+ RGF FVTF D   V+ ++  
Sbjct: 127 KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQ 186

Query: 269 GPHQLDGRTIDPK 307
             H ++G   + K
Sbjct: 187 KYHTINGHNCEVK 199



 Score = 31.9 bits (69), Expect = 1.7
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F +YGK+  + +M D+   K  G  F++F+D
Sbjct: 145 YFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176


>S63912-1|AAB27595.1|  269|Homo sapiens FBRNP protein.
          Length = 269

 Score = 89.0 bits (211), Expect = 1e-17
 Identities = 42/117 (35%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGLS+ET+ ++L+ +F ++G + DC+VM++ ++ RSRGFGFVT++  + V
Sbjct: 30  EPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCLVMRDPQTKRSRGFGFVTYSCVTEV 89

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           +  +   P ++DGR ++PK    R    KP       K+F+G +  +  E +LR  F
Sbjct: 90  DAAIGARPFKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGSIKEDTEEYNLRDYF 146



 Score = 62.9 bits (146), Expect = 8e-10
 Identities = 31/93 (33%), Positives = 52/93 (55%), Gaps = 5/93 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG +  +T + NL+ YF +YG++    VM++ +SG+ RGF  VTF D   V+ ++  
Sbjct: 127 KIFVGSIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFASVTFDDHDTVDKIVVQ 186

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPK-----RGGG 352
             H ++G   + K    + + +P      RGGG
Sbjct: 187 KYHTINGHNCEVKKALAKQVMQPAGSQRGRGGG 219


>U23803-1|AAA65094.1|  305|Homo sapiens heterogeneous
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>CR456986-1|CAG33267.1|  305|Homo sapiens HNRPA0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC030249-1|AAH30249.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC028976-1|AAH28976.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC019271-1|AAH19271.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC018949-1|AAH18949.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC012980-1|AAH12980.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC011972-1|AAH11972.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC009284-1|AAH09284.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC007271-1|AAH07271.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC001008-1|AAH01008.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 85.4 bits (202), Expect = 1e-16
 Identities = 42/114 (36%), Positives = 68/114 (59%), Gaps = 1/114 (0%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++ +  KLF+GGL+ +TS+  L+ +F  +G + DCVV+ N ++ RSR FGFVT+++   
Sbjct: 1   MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDL 406
            +  +   PH +DG T++ K    R    +P       K+F+GGL  +V E DL
Sbjct: 61  ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 56.4 bits (130), Expect = 7e-08
 Identities = 30/96 (31%), Positives = 49/96 (51%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  + ++ +L  +FS++G V    ++ + +SG+ RGFGFV F +    +     
Sbjct: 99  KLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVV 158

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
             H + G  ++ K   P+       GGG  +   GG
Sbjct: 159 KFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGG 194


>BC004945-1|AAH04945.1|  298|Homo sapiens Unknown (protein for
           IMAGE:3615335) protein.
          Length = 298

 Score = 83.4 bits (197), Expect = 5e-16
 Identities = 40/103 (38%), Positives = 63/103 (61%), Gaps = 1/103 (0%)
 Frame = +2

Query: 113 WETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGR 292
           +ET+ E+L+ +F ++G + DCVVM++  + RSRGFGFVT+A    V+  +   PH++DGR
Sbjct: 1   FETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGR 60

Query: 293 TIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            ++PK    R   Q+P       K+F+GG+  +  E  LR  F
Sbjct: 61  VVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYF 103



 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + +L+ YF +YG++    +M +  SG+ RGF FVTF D   V+ ++  
Sbjct: 84  KIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQ 143

Query: 269 GPHQLDGRTID 301
             H ++G   +
Sbjct: 144 KYHTVNGHNCE 154



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +F +YGK+  + IM D+   K  G  F++F+D  S
Sbjct: 102 YFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDS 136


>U28686-1|AAB17212.1|  157|Homo sapiens RNPL protein.
          Length = 157

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 39/94 (41%), Positives = 62/94 (65%), Gaps = 2/94 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+GKLFVGGL++ T ++ L+ +FS +G + + VV+K+ E+ RSRGFGF+TF +P   ++ 
Sbjct: 4   EEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVA 63

Query: 260 LQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
           ++  NG   LDGR I  +  +     +  RGGG+
Sbjct: 64  MRAMNG-ESLDGRQI--RVDHAGKSARGTRGGGF 94



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F  +G + EVV++ D+  ++S G GF++F
Sbjct: 26  FSSFGPISEVVVVKDRETQRSRGFGFITF 54


>D78134-1|BAA11212.1|  172|Homo sapiens CIRP protein.
          Length = 172

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVN 253
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF   D +   
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA 63

Query: 254 LVLQNGPHQLDGRTI 298
           ++  NG   +DGR I
Sbjct: 64  MMAMNG-KSVDGRQI 77



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>BT007210-1|AAP35874.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVN 253
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF   D +   
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA 63

Query: 254 LVLQNGPHQLDGRTI 298
           ++  NG   +DGR I
Sbjct: 64  MMAMNG-KSVDGRQI 77



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>BC006825-1|AAH06825.1|  157|Homo sapiens RNA binding motif (RNP1,
           RRM) protein 3 protein.
          Length = 157

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 39/94 (41%), Positives = 62/94 (65%), Gaps = 2/94 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           E+GKLFVGGL++ T ++ L+ +FS +G + + VV+K+ E+ RSRGFGF+TF +P   ++ 
Sbjct: 4   EEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVA 63

Query: 260 LQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGY 355
           ++  NG   LDGR I  +  +     +  RGGG+
Sbjct: 64  MRAMNG-ESLDGRQI--RVDHAGKSARGTRGGGF 94



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 11/29 (37%), Positives = 20/29 (68%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F  +G + EVV++ D+  ++S G GF++F
Sbjct: 26  FSSFGPISEVVVVKDRETQRSRGFGFITF 54


>BC000901-1|AAH00901.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVN 253
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF   D +   
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA 63

Query: 254 LVLQNGPHQLDGRTI 298
           ++  NG   +DGR I
Sbjct: 64  MMAMNG-KSVDGRQI 77



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>BC000403-1|AAH00403.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVN 253
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF   D +   
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA 63

Query: 254 LVLQNGPHQLDGRTI 298
           ++  NG   +DGR I
Sbjct: 64  MMAMNG-KSVDGRQI 77



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>AF021336-1|AAC51787.1|  172|Homo sapiens DNA damage-inducible RNA
           binding protein protein.
          Length = 172

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVN 253
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF   D +   
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA 63

Query: 254 LVLQNGPHQLDGRTI 298
           ++  NG   +DGR I
Sbjct: 64  MMAMNG-KSVDGRQI 77



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>AC004258-1|AAC04895.1|  172|Homo sapiens CIRP protein.
          Length = 172

 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 36/75 (48%), Positives = 57/75 (76%), Gaps = 2/75 (2%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVN 253
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF   D +   
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA 63

Query: 254 LVLQNGPHQLDGRTI 298
           ++  NG   +DGR I
Sbjct: 64  MMAMNG-KSVDGRQI 77



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>U23731-1|AAA70033.1|  414|Homo sapiens TAR DNA-binding protein-43
           protein.
          Length = 414

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>EF434182-1|ABO32291.1|  414|Homo sapiens TDP43 splice variant 1
           protein.
          Length = 414

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>EF434181-1|ABO32290.1|  416|Homo sapiens TDP43 protein.
          Length = 416

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>CR533534-1|CAG38565.1|  414|Homo sapiens TARDBP protein.
          Length = 414

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>BC095435-1|AAH95435.1|  414|Homo sapiens TAR DNA binding protein
           protein.
          Length = 414

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>BC071657-1|AAH71657.1|  414|Homo sapiens TARDBP protein protein.
          Length = 414

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>AL109811-2|CAI22099.1|  295|Homo sapiens TAR DNA binding protein
           protein.
          Length = 295

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 41.1 bits (92), Expect = 0.003
 Identities = 20/53 (37%), Positives = 33/53 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQI 239


>AL109811-1|CAI22098.1|  414|Homo sapiens TAR DNA binding protein
           protein.
          Length = 414

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTEDMTEDELREFF 211



 Score = 44.0 bits (99), Expect = 4e-04
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTEDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>AK222754-1|BAD96474.1|  414|Homo sapiens TAR DNA binding protein
           variant protein.
          Length = 414

 Score = 74.1 bits (174), Expect = 3e-13
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++++L+ YFS +GEV+   V K+ ++G S+GFGFV F +     + + + 
Sbjct: 106 LIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYE-TQVKVMSQ 164

Query: 272 PHQLDGRTIDPK-PCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            H +DGR  D K P + ++  +P R     KVF+G    ++TE +LR  F
Sbjct: 165 RHMIDGRWCDCKLPNSKQSQDEPLRS---RKVFVGRCTGDMTEDELREFF 211



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 6/99 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV------ 250
           K+FVG  + + +++ L+ +FS+YG+V+D  + K       R F FVTFAD  +       
Sbjct: 192 KVFVGRCTGDMTEDELREFFSQYGDVMDVFIPK-----PFRAFAFVTFADDQIAQSLCGE 246

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVF 367
           +L+++     +     +PK  + R L++  R GG P  F
Sbjct: 247 DLIIKGISVHIS--NAEPKHNSNRQLERSGRFGGNPGGF 283


>AK128423-1|BAC87434.1|  135|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46566 fis, clone THYMU3040829, moderately
           similar to Cold-inducible RNA-binding protein. ).
          Length = 135

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 29/51 (56%), Positives = 46/51 (90%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++GKLFVGGLS++T++++L++ FS+YG++ + VV+K+ E+ RSRGFGFVTF
Sbjct: 4   DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTF 54



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/31 (41%), Positives = 24/31 (77%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG++ EVV++ D+  ++S G GF++FE+
Sbjct: 26  FSKYGQISEVVVVKDRETQRSRGFGFVTFEN 56


>AF069682-1|AAC24858.2|  392|Homo sapiens testes specific
           heterogenous nuclear ribonucleoprotein G-T protein.
          Length = 392

 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 33/99 (33%), Positives = 56/99 (56%), Gaps = 1/99 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET ++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 248 VNLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
                ++     LDG+ I          +  +RG   P+
Sbjct: 62  AKAAARDMNGKSLDGKAIKVAQATKPAFESSRRGPPPPR 100



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>Z23064-1|CAA80599.1|  391|Homo sapiens hnRNP G protein protein.
          Length = 391

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 32/94 (34%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS- 244
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG 346
             +         LDG+ I  +     + +  +RG
Sbjct: 62  AKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG 95



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>BC007435-1|AAH07435.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 32/94 (34%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS- 244
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG 346
             +         LDG+ I  +     + +  +RG
Sbjct: 62  AKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG 95



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>BC006550-1|AAH06550.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 32/94 (34%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS- 244
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG 346
             +         LDG+ I  +     + +  +RG
Sbjct: 62  AKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG 95



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AY464692-1|AAR28036.1|  391|Homo sapiens heterogeneous nuclear
           ribonucleoprotein G protein.
          Length = 391

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 32/94 (34%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS- 244
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG 346
             +         LDG+ I  +     + +  +RG
Sbjct: 62  AKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG 95



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AL683813-6|CAI39448.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 32/94 (34%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS- 244
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG 346
             +         LDG+ I  +     + +  +RG
Sbjct: 62  AKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG 95



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AF266723-1|AAK58567.1|  391|Homo sapiens RBMX protein.
          Length = 391

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 32/94 (34%), Positives = 56/94 (59%), Gaps = 1/94 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS- 244
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRG 346
             +         LDG+ I  +     + +  +RG
Sbjct: 62  AKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG 95



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AB073212-1|BAB70469.1|  179|Homo sapiens Musashi1 protein.
          Length = 179

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T+ E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 33  RAQPKMVTRTK-KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 91

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 92  ESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSP 126



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 28/64 (43%), Positives = 36/64 (56%)
 Frame = +2

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
           TF D + V+ VL    H+LD +TIDPK   PR  Q PK      K+F+GGL  N T  D+
Sbjct: 1   TFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSVNTTVEDV 59

Query: 407 RXIF 418
           +  F
Sbjct: 60  KQYF 63



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE E
Sbjct: 62  YFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESE 94


>AB072592-1|BAB69769.1|  181|Homo sapiens Musashi1 protein.
          Length = 181

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T+ E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 36  RAQPKMVTRTK-KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 94

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 95  ESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSP 129



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 31/67 (46%), Positives = 39/67 (58%)
 Frame = +2

Query: 218 GFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
           GFVTF D + V+ VL    H+LD +TIDPK   PR  Q PK      K+F+GGL  N T 
Sbjct: 1   GFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSVNTTV 59

Query: 398 TDLRXIF 418
            D++  F
Sbjct: 60  EDVKQYF 66



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE E
Sbjct: 65  YFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESE 97


>AB072591-1|BAB69768.1|  181|Homo sapiens Musashi1 protein.
          Length = 181

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T+ E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 36  RAQPKMVTRTK-KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 94

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 95  ESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSP 129



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 31/67 (46%), Positives = 39/67 (58%)
 Frame = +2

Query: 218 GFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
           GFVTF D + V+ VL    H+LD +TIDPK   PR  Q PK      K+F+GGL  N T 
Sbjct: 1   GFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSVNTTV 59

Query: 398 TDLRXIF 418
            D++  F
Sbjct: 60  EDVKQYF 66



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE E
Sbjct: 65  YFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESE 97


>AB072590-1|BAB69767.1|  180|Homo sapiens Musashi1 protein.
          Length = 180

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 34/95 (35%), Positives = 57/95 (60%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R  P M    K K+FVGGLS  T+ E++++YF ++G+V D ++M +  + R RGFGFVTF
Sbjct: 36  RAQPKMVTRTK-KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTF 94

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V  V +   H+++ + ++ K   P+ +  P
Sbjct: 95  ESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSP 129



 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 31/67 (46%), Positives = 39/67 (58%)
 Frame = +2

Query: 218 GFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
           GFVTF D + V+ VL    H+LD +TIDPK   PR  Q PK      K+F+GGL  N T 
Sbjct: 1   GFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQ-PKMVTRTKKIFVGGLSVNTTV 59

Query: 398 TDLRXIF 418
            D++  F
Sbjct: 60  EDVKQYF 66



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE E
Sbjct: 65  YFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESE 97


>BC057796-1|AAH57796.1|  392|Homo sapiens RNA binding motif protein,
           X-linked-like 2 protein.
          Length = 392

 Score = 70.1 bits (164), Expect = 5e-12
 Identities = 32/99 (32%), Positives = 55/99 (55%), Gaps = 1/99 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GG + ET ++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGFNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPAD 61

Query: 248 VNLVLQN-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
                ++     LDG+ I          +  +RG   P+
Sbjct: 62  AKAAARDMNGKSLDGKAIKVAQATKPAFESSRRGPPPPR 100



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AF279289-1|AAF82129.1|  386|Homo sapiens testes-specific
           heterogenous nuclear ribonucleoprotein G-T protein.
          Length = 386

 Score = 70.1 bits (164), Expect = 5e-12
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +2

Query: 86  GKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           GKLF+GGL+ ET ++ L+  F +YG +++ ++MK+ E+ +SRGF FVTF  P+     ++
Sbjct: 2   GKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAVR 61

Query: 266 N-GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPK 361
           +     LDG+ I          +  +RG   P+
Sbjct: 62  DMNGKSLDGKAIKVAQATKPAFESSRRGPPPPR 94



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV++M D+   KS G  F++FE
Sbjct: 22  FGKYGRIVEVLLMKDRETNKSRGFAFVTFE 51


>DQ120650-1|ABB92435.1|  384|Homo sapiens RBM1 protein.
          Length = 384

 Score = 69.3 bits (162), Expect = 9e-12
 Identities = 30/90 (33%), Positives = 56/90 (62%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ +++K+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPA- 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
                ++    ++G+++D K        KP
Sbjct: 61  ---DAKDAARDMNGKSLDGKAIKVEQATKP 87



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/30 (43%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV+++ D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLIKDRETNKSRGFAFVTFE 57


>BC012942-1|AAH12942.1|  390|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 390

 Score = 69.3 bits (162), Expect = 9e-12
 Identities = 30/90 (33%), Positives = 56/90 (62%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ +++K+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPA- 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
                ++    ++G+++D K        KP
Sbjct: 61  ---DAKDAARDMNGKSLDGKAIKVEQATKP 87



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/30 (43%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV+++ D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLIKDRETNKSRGFAFVTFE 57


>AL139416-3|CAI21694.1|  159|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 159

 Score = 69.3 bits (162), Expect = 9e-12
 Identities = 30/90 (33%), Positives = 56/90 (62%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ +++K+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPA- 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
                ++    ++G+++D K        KP
Sbjct: 61  ---DAKDAARDMNGKSLDGKAIKVEQATKP 87



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/30 (43%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV+++ D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLIKDRETNKSRGFAFVTFE 57


>AL139416-2|CAI21693.1|  390|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 390

 Score = 69.3 bits (162), Expect = 9e-12
 Identities = 30/90 (33%), Positives = 56/90 (62%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ +++K+ E+ +SRGF FVTF  P+ 
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPA- 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
                ++    ++G+++D K        KP
Sbjct: 61  ---DAKDAARDMNGKSLDGKAIKVEQATKP 87



 Score = 36.7 bits (81), Expect = 0.061
 Identities = 13/30 (43%), Positives = 23/30 (76%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           FG+YG+++EV+++ D+   KS G  F++FE
Sbjct: 28  FGKYGRIVEVLLIKDRETNKSRGFAFVTFE 57


>AK056850-1|BAB71295.1|  289|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32288 fis, clone PROST2000325, highly similar to
           Homo sapiens DAZ associated protein 1 (DAZAP1) mRNA. ).
          Length = 289

 Score = 69.3 bits (162), Expect = 9e-12
 Identities = 30/92 (32%), Positives = 51/92 (55%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G +  P  D+ +  K+FVGG+     +  L+ YF ++G V + V++ ++E  R RGFGF+
Sbjct: 11  GWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFI 70

Query: 227 TFADPSLVNLVLQNGPHQLDGRTIDPKPCNPR 322
           TF D   V+  +    H + G+ ++ K   PR
Sbjct: 71  TFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 102



 Score = 43.2 bits (97), Expect = 7e-04
 Identities = 18/39 (46%), Positives = 28/39 (71%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXSX*QS 530
           +F ++G V EVV++YD  K++  G GF++FEDE S  Q+
Sbjct: 43  YFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQA 81



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 359 KVFLGGLPSNVTETDLRXIFR 421
           K+F+GG+P N  ET+LR  F+
Sbjct: 25  KIFVGGIPHNCGETELREYFK 45


>BC017560-1|AAH17560.1|  151|Homo sapiens MSI2 protein protein.
          Length = 151

 Score = 68.1 bits (159), Expect = 2e-11
 Identities = 30/83 (36%), Positives = 53/83 (63%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGLS  T  E++++YF ++G+V D ++M +  + R RGFGFVTF +  +V  V + 
Sbjct: 7   KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEI 66

Query: 269 GPHQLDGRTIDPKPCNPRTLQKP 337
             H+++ + ++ K   P+ +  P
Sbjct: 67  HFHEINNKMVECKKAQPKEVMFP 89



 Score = 35.9 bits (79), Expect = 0.11
 Identities = 12/33 (36%), Positives = 24/33 (72%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++GKV + ++M+D+   +  G GF++FE+E
Sbjct: 25  YFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENE 57


>AY547318-1|AAS55633.1|  236|Homo sapiens unknown protein.
          Length = 236

 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 29/79 (36%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M+    D    K+FVGGL + T+  +L++YF  +GE+ + VV+ + ++G+SRG+GFVT A
Sbjct: 1   MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMA 60

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D +      ++    +DGR
Sbjct: 61  DRAAAERACKDPNPIIDGR 79



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 353 YPKVFLGGLPSNVTETDLRXIFRTLWE 433
           Y K+F+GGLP + T+  LR  F    E
Sbjct: 10  YTKIFVGGLPYHTTDASLRKYFEVFGE 36


>AL136305-1|CAC36889.1|  236|Homo sapiens protein ( Human DNA
           sequence from clone RP1-259A10 on chromosome 6p22.1-23
           Contains the gene for an ssDNA binding protein and a CpG
           island.  ).
          Length = 236

 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 29/79 (36%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M+    D    K+FVGGL + T+  +L++YF  +GE+ + VV+ + ++G+SRG+GFVT A
Sbjct: 1   MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMA 60

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D +      ++    +DGR
Sbjct: 61  DRAAAERACKDPNPIIDGR 79



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 353 YPKVFLGGLPSNVTETDLRXIFRTLWE 433
           Y K+F+GGLP + T+  LR  F    E
Sbjct: 10  YTKIFVGGLPYHTTDASLRKYFEVFGE 36


>AK095016-1|BAC04474.1|  211|Homo sapiens protein ( Homo sapiens
           cDNA FLJ37697 fis, clone BRHIP2015360, highly similar to
           Xenopus laevis RRM-containing protein SEB-4 mRNA. ).
          Length = 211

 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 29/79 (36%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M+    D    K+FVGGL + T+  +L++YF  +GE+ + VV+ + ++G+SRG+GFVT A
Sbjct: 1   MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMA 60

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D +      ++    +DGR
Sbjct: 61  DRAAAERACKDPNPIIDGR 79



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +2

Query: 353 YPKVFLGGLPSNVTETDLRXIFRTLWE 433
           Y K+F+GGLP + T+  LR  F    E
Sbjct: 10  YTKIFVGGLPYHTTDASLRKYFEVFGE 36


>BC018711-1|AAH18711.1|  216|Homo sapiens RBM38 protein protein.
          Length = 216

 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M+    D    K+FVGGL + T+  +L++YF  +G++ + VV+ + ++G+SRG+GFVT A
Sbjct: 1   MHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMA 60

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D +      ++    +DGR
Sbjct: 61  DRAAAERACKDPNPIIDGR 79


>AF432218-1|AAL99924.1|  216|Homo sapiens CLL-associated antigen
           KW-5 protein.
          Length = 216

 Score = 63.7 bits (148), Expect = 5e-10
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           M+    D    K+FVGGL + T+  +L++YF  +G++ + VV+ + ++G+SRG+GFVT A
Sbjct: 1   MHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMA 60

Query: 236 DPSLVNLVLQNGPHQLDGR 292
           D +      ++    +DGR
Sbjct: 61  DRAAAERACKDPNPIIDGR 79


>X75315-1|CAA53064.1|  230|Homo sapiens SEB4B protein.
          Length = 230

 Score = 62.9 bits (146), Expect = 8e-10
 Identities = 26/68 (38%), Positives = 46/68 (67%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL + T+  +L++YF  +G++ + VV+ + ++G+SRG+GFVT AD +      ++
Sbjct: 26  KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD 85

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 86  PNPIIDGR 93



 Score = 31.5 bits (68), Expect = 2.3
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +2

Query: 338 KRGGGYPKVFLGGLPSNVTETDLRXIF 418
           K+G  + K+F+GGLP + T+  LR  F
Sbjct: 19  KKGTTFTKIFVGGLPYHTTDASLRKYF 45


>X75314-1|CAA53063.1|  229|Homo sapiens SEB4D protein.
          Length = 229

 Score = 62.9 bits (146), Expect = 8e-10
 Identities = 26/68 (38%), Positives = 46/68 (67%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGGL + T+  +L++YF  +G++ + VV+ + ++G+SRG+GFVT AD +      ++
Sbjct: 25  KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKD 84

Query: 269 GPHQLDGR 292
               +DGR
Sbjct: 85  PNPIIDGR 92



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +2

Query: 317 PRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           P  +   ++G  + K+F+GGLP + T+  LR  F
Sbjct: 11  PGVMYGSQKGTTFTKIFVGGLPYHTTDASLRKYF 44


>U36608-1|AAC16917.1|  220|Homo sapiens Y-chromosome RNA recognition
           motif protein protein.
          Length = 220

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 31/96 (32%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F ++G + + +++K+  S +SRGF F+TF +P+ 
Sbjct: 2   VEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTS-KSRGFAFITFENPA- 59

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGG 352
                +N    ++G+++  K       QKP  + GG
Sbjct: 60  ---DAKNAAKDMNGKSLHGKAIKVEQAQKPSFQSGG 92


>AL354775-1|CAI12730.1|  276|Homo sapiens protein ( Human DNA
           sequence from clone RP11-223F20 on chromosome 13
           Contains a novel heterogeneous nuclear ribonucleoprotein
           family A protein and).
          Length = 276

 Score = 60.1 bits (139), Expect = 6e-09
 Identities = 25/73 (34%), Positives = 45/73 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+  +T + NL+ YF +  ++    VM++ +SG+ RGF FVTF D  +++ ++  
Sbjct: 24  KIFVGGIKEDTEEYNLRDYFEKCSKIETIEVMEDRQSGKKRGFAFVTFDDHDIIDKIVVQ 83

Query: 269 GPHQLDGRTIDPK 307
             H ++G   + K
Sbjct: 84  KYHTINGHNCEVK 96


>X76059-1|CAA53659.1|  496|Homo sapiens protein ( H.sapiens mRNA for
           YRRM1. ).
          Length = 496

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 30/96 (31%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F ++G + + +++K+  S +SRGF F+TF +P+ 
Sbjct: 2   VEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTS-KSRGFAFITFENPA- 59

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGG 352
                +N    ++G+++  K       +KP  + GG
Sbjct: 60  ---DAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGG 92


>BC070298-1|AAH70298.1|  459|Homo sapiens RBMY1A1 protein protein.
          Length = 459

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 30/96 (31%), Positives = 58/96 (60%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F ++G + + +++K+  S +SRGF F+TF +P+ 
Sbjct: 2   VEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTS-KSRGFAFITFENPA- 59

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGG 352
                +N    ++G+++  K       +KP  + GG
Sbjct: 60  ---DAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGG 92


>X76060-1|CAA53660.1|  419|Homo sapiens YRRM2 protein.
          Length = 419

 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 30/96 (31%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F ++G + + +++K+  S +SRGF F+TF +P+ 
Sbjct: 2   VEADHAGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTS-KSRGFAFITFENPA- 59

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGG 352
                +N    ++G ++  K       +KP  + GG
Sbjct: 60  ---DAKNAAKDMNGTSLHGKAIKVEQAKKPSFQSGG 92


>BC030018-1|AAH30018.1|  496|Homo sapiens RNA binding motif protein,
           Y-linked, family 1, member F protein.
          Length = 496

 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 30/96 (31%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ ET+++ L+  F ++G + + +++K+  S +SRGF F+TF +P+ 
Sbjct: 2   VEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTS-KSRGFAFITFENPA- 59

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGG 352
                +N    ++G ++  K       +KP  + GG
Sbjct: 60  ---DAKNAAKDMNGTSLHGKAIKVEQAKKPSFQSGG 92


>BC024208-1|AAH24208.1|  423|Homo sapiens RNA binding motif protein
           23 protein.
          Length = 423

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/70 (37%), Positives = 47/70 (67%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G++ + V+MK+S++GRS+G+GF+TF+D       L+ 
Sbjct: 248 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQ 307

Query: 266 -NGPHQLDGR 292
            NG  +L GR
Sbjct: 308 LNG-FELAGR 316



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 7/127 (5%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N   ++ +   +F   L+      +L+ +FS  G+V D  ++ +  S RS+G  +V F +
Sbjct: 141 NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCE 200

Query: 239 PSLVNLVLQNGPHQLDGRTI-------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
              V L +     +L G  I       +            K  GG  ++++G L  N+TE
Sbjct: 201 IQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITE 260

Query: 398 TDLRXIF 418
             LR IF
Sbjct: 261 DMLRGIF 267



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +GK+  +V+M D    +S G GF++F D
Sbjct: 247 MRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSD 297


>BC002566-1|AAH02566.1|  424|Homo sapiens RNA binding motif protein
           23 protein.
          Length = 424

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/70 (37%), Positives = 47/70 (67%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G++ + V+MK+S++GRS+G+GF+TF+D       L+ 
Sbjct: 248 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQ 307

Query: 266 -NGPHQLDGR 292
            NG  +L GR
Sbjct: 308 LNG-FELAGR 316



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 7/127 (5%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N   ++ +   +F   L+      +L+ +FS  G+V D  ++ +  S RS+G  +V F +
Sbjct: 141 NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCE 200

Query: 239 PSLVNLVLQNGPHQLDGRTI-------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
              V L +     +L G  I       +            K  GG  ++++G L  N+TE
Sbjct: 201 IQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITE 260

Query: 398 TDLRXIF 418
             LR IF
Sbjct: 261 DMLRGIF 267



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +GK+  +V+M D    +S G GF++F D
Sbjct: 247 MRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSD 297


>AK001344-1|BAA91638.1|  406|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10482 fis, clone NT2RP2000153, weakly similar to
           GAR2 PROTEIN. ).
          Length = 406

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/70 (37%), Positives = 47/70 (67%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G++ + V+MK+S++GRS+G+GF+TF+D       L+ 
Sbjct: 230 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQ 289

Query: 266 -NGPHQLDGR 292
            NG  +L GR
Sbjct: 290 LNG-FELAGR 298



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 7/127 (5%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N   ++ +   +F   L+      +L+ +FS  G+V D  ++ +  S RS+G  +V F +
Sbjct: 123 NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCE 182

Query: 239 PSLVNLVLQNGPHQLDGRTI-------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
              V L +     +L G  I       +            K  GG  ++++G L  N+TE
Sbjct: 183 IQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITE 242

Query: 398 TDLRXIF 418
             LR IF
Sbjct: 243 DMLRGIF 249



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +GK+  +V+M D    +S G GF++F D
Sbjct: 229 MRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSD 279


>AF275678-1|AAG24388.1|  418|Homo sapiens PP239 protein protein.
          Length = 418

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/70 (37%), Positives = 47/70 (67%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G++ + V+MK+S++GRS+G+GF+TF+D       L+ 
Sbjct: 242 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQ 301

Query: 266 -NGPHQLDGR 292
            NG  +L GR
Sbjct: 302 LNG-FELAGR 310



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 7/127 (5%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N   ++ +   +F   L+      +L+ +FS  G+V D  ++ +  S RS+G  +V F +
Sbjct: 135 NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCE 194

Query: 239 PSLVNLVLQNGPHQLDGRTI-------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
              V L +     +L G  I       +            K  GG  ++++G L  N+TE
Sbjct: 195 IQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITE 254

Query: 398 TDLRXIF 418
             LR IF
Sbjct: 255 DMLRGIF 261



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +GK+  +V+M D    +S G GF++F D
Sbjct: 241 MRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSD 291


>AF087905-1|AAP97203.1|  425|Homo sapiens splicing factor SF2
           protein.
          Length = 425

 Score = 53.6 bits (123), Expect = 5e-07
 Identities = 20/50 (40%), Positives = 39/50 (78%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +L+VG L +  +++ L+  F  +G++ + V+MK+S++GRS+G+GF+TF+D
Sbjct: 248 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSD 297



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 7/127 (5%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N   ++ +   +F   L+      +L+ +FS  G+V D  ++ +  S RS+G  +V F +
Sbjct: 141 NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCE 200

Query: 239 PSLVNLVLQNGPHQLDGRTI-------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
              V L +     +L G  I       +            K  GG  ++++G L  N+TE
Sbjct: 201 IQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITE 260

Query: 398 TDLRXIF 418
             LR IF
Sbjct: 261 DMLRGIF 267



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +GK+  +V+M D    +S G GF++F D
Sbjct: 247 MRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSD 297


>AC016700-3|AAX93193.1|  386|Homo sapiens unknown protein.
          Length = 386

 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 7/108 (6%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQN 268
           +FVG LS E + E+++  F+ +G + D  V+K+  +G+S+G+GFV+F +     N + Q 
Sbjct: 108 VFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQM 167

Query: 269 GPHQLDGRTI-----DPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVT 394
           G   L GR I       KP  P+ T +   +   Y +V     PSN T
Sbjct: 168 GGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCT 215



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 28/129 (21%), Positives = 58/129 (44%), Gaps = 12/129 (9%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD--P 241
           M+D+    L+VG LS + ++  + + FS+ G   +C ++   ++  +  + FV F +   
Sbjct: 1   MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMI--MDTAGNDPYCFVEFHEHRH 58

Query: 242 SLVNLVLQNGPHQLDGRTI----------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNV 391
           +   L   NG  ++ G+ +            K  +  T+   +R   +  VF+G L   +
Sbjct: 59  AAAALAAMNG-RKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEI 117

Query: 392 TETDLRXIF 418
           T  D++  F
Sbjct: 118 TTEDIKAAF 126


>CR457257-1|CAG33538.1|  423|Homo sapiens RNPC4 protein.
          Length = 423

 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 25/70 (35%), Positives = 46/70 (65%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G++ + V+MK+S++GRS+G+G +TF+D       L+ 
Sbjct: 248 RLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGLITFSDSECARRALEQ 307

Query: 266 -NGPHQLDGR 292
            NG  +L GR
Sbjct: 308 LNG-FELAGR 316



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 7/127 (5%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N   ++ +   +F   L+      +L+ +FS  G+V D  ++ +  S RS+G  +V F +
Sbjct: 141 NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCE 200

Query: 239 PSLVNLVLQNGPHQLDGRTI-------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTE 397
              V L +     +L G  I       +            K  GG  ++++G L  N+TE
Sbjct: 201 IQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITE 260

Query: 398 TDLRXIF 418
             LR IF
Sbjct: 261 DMLRGIF 267



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 13/51 (25%), Positives = 25/51 (49%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +GK+  +V+M D    +S G G ++F D
Sbjct: 247 MRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGLITFSD 297


>BC033674-1|AAH33674.1|  283|Homo sapiens bol, boule-like
           (Drosophila) protein.
          Length = 283

 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 23/59 (38%), Positives = 41/59 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++FVGG+ ++T++ +L+++FS+YG V + V + N  +G S+G+GFVTF        +LQ
Sbjct: 34  RIFVGGIDFKTNESDLRKFFSQYGSVKE-VKIVNDRAGVSKGYGFVTFETQEDAQKILQ 91



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF +YG V EV I+ D+    S G GF++FE +
Sbjct: 52  FFSQYGSVKEVKIVNDRA-GVSKGYGFVTFETQ 83



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 5/52 (9%)
 Frame = +2

Query: 278 QLDGRTIDPKPCNPRTLQKPKRGGGYP-----KVFLGGLPSNVTETDLRXIF 418
           Q D  +  P P +P  L  P     Y      ++F+GG+     E+DLR  F
Sbjct: 2   QTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFF 53


>AM295005-1|CAL25726.1|  289|Homo sapiens boll protein protein.
          Length = 289

 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 23/59 (38%), Positives = 41/59 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++FVGG+ ++T++ +L+++FS+YG V + V + N  +G S+G+GFVTF        +LQ
Sbjct: 40  RIFVGGIDFKTNESDLRKFFSQYGSVKE-VKIVNDRAGVSKGYGFVTFETQEDAQKILQ 97



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF +YG V EV I+ D+    S G GF++FE +
Sbjct: 58  FFSQYGSVKEVKIVNDRA-GVSKGYGFVTFETQ 89



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 5/52 (9%)
 Frame = +2

Query: 278 QLDGRTIDPKPCNPRTLQKPKRGGGYP-----KVFLGGLPSNVTETDLRXIF 418
           Q D  +  P P +P  L  P     Y      ++F+GG+     E+DLR  F
Sbjct: 8   QTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFF 59


>AK093453-1|BAC04171.1|  339|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36134 fis, clone TESTI2024648, weakly similar to
           Homo sapiens germline specific RNA binding protein
           (DAZL1) mRNA. ).
          Length = 339

 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 23/59 (38%), Positives = 41/59 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++FVGG+ ++T++ +L+++FS+YG V + V + N  +G S+G+GFVTF        +LQ
Sbjct: 40  RIFVGGIDFKTNESDLRKFFSQYGSVKE-VKIVNDRAGVSKGYGFVTFETQEDAQKILQ 97



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF +YG V EV I+ D+    S G GF++FE +
Sbjct: 58  FFSQYGSVKEVKIVNDRA-GVSKGYGFVTFETQ 89



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 5/52 (9%)
 Frame = +2

Query: 278 QLDGRTIDPKPCNPRTLQKPKRGGGYP-----KVFLGGLPSNVTETDLRXIF 418
           Q D  +  P P +P  L  P     Y      ++F+GG+     E+DLR  F
Sbjct: 8   QTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFF 59


>AK058099-1|BAB71664.1|  283|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25370 fis, clone TST01870. ).
          Length = 283

 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 23/59 (38%), Positives = 41/59 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++FVGG+ ++T++ +L+++FS+YG V + V + N  +G S+G+GFVTF        +LQ
Sbjct: 34  RIFVGGIDFKTNESDLRKFFSQYGSVKE-VKIVNDRAGVSKGYGFVTFETQEDAQKILQ 91



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF +YG V EV I+ D+    S G GF++FE +
Sbjct: 52  FFSQYGSVKEVKIVNDRA-GVSKGYGFVTFETQ 83



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 5/52 (9%)
 Frame = +2

Query: 278 QLDGRTIDPKPCNPRTLQKPKRGGGYP-----KVFLGGLPSNVTETDLRXIF 418
           Q D  +  P P +P  L  P     Y      ++F+GG+     E+DLR  F
Sbjct: 2   QTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFF 53


>AF272858-1|AAK58689.1|  283|Homo sapiens BOULE protein.
          Length = 283

 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 23/59 (38%), Positives = 41/59 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++FVGG+ ++T++ +L+++FS+YG V + V + N  +G S+G+GFVTF        +LQ
Sbjct: 34  RIFVGGIDFKTNESDLRKFFSQYGSVKE-VKIVNDRAGVSKGYGFVTFETQEDAQKILQ 91



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF +YG V EV I+ D+    S G GF++FE +
Sbjct: 52  FFSQYGSVKEVKIVNDRA-GVSKGYGFVTFETQ 83



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 5/52 (9%)
 Frame = +2

Query: 278 QLDGRTIDPKPCNPRTLQKPKRGGGYP-----KVFLGGLPSNVTETDLRXIF 418
           Q D  +  P P +P  L  P     Y      ++F+GG+     E+DLR  F
Sbjct: 2   QTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFF 53


>AC011997-1|AAX93045.1|  283|Homo sapiens unknown protein.
          Length = 283

 Score = 52.8 bits (121), Expect = 9e-07
 Identities = 23/59 (38%), Positives = 41/59 (69%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++FVGG+ ++T++ +L+++FS+YG V + V + N  +G S+G+GFVTF        +LQ
Sbjct: 34  RIFVGGIDFKTNESDLRKFFSQYGSVKE-VKIVNDRAGVSKGYGFVTFETQEDAQKILQ 91



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           FF +YG V EV I+ D+    S G GF++FE +
Sbjct: 52  FFSQYGSVKEVKIVNDRA-GVSKGYGFVTFETQ 83



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 5/52 (9%)
 Frame = +2

Query: 278 QLDGRTIDPKPCNPRTLQKPKRGGGYP-----KVFLGGLPSNVTETDLRXIF 418
           Q D  +  P P +P  L  P     Y      ++F+GG+     E+DLR  F
Sbjct: 2   QTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFF 53


>U29943-1|AAA70417.1|  346|Homo sapiens Hel-N2 protein.
          Length = 346

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D K  L V  L    +QE L+  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 35  EDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 95  KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 145



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 173



 Score = 32.3 bits (70), Expect = 1.3
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FV  L+ +  +  L + F  +G V +  V+++  + + +GFGFVT  +
Sbjct: 265 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTN 313



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 129 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174


>U12431-1|AAA69698.1|  359|Homo sapiens ELAV-like neuronal protein 1
           protein.
          Length = 359

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D K  L V  L    +QE L+  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 35  EDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 95  KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 145



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 173



 Score = 32.3 bits (70), Expect = 1.3
 Identities = 14/49 (28%), Positives = 28/49 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FV  L+ +  +  L + F  +G V +  V+++  + + +GFGFVT  +
Sbjct: 278 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTN 326



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 129 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174


>M62843-1|AAA58396.1|  380|Homo sapiens brain protein protein.
          Length = 380

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 299 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 358

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 359 NG-YRLGDRVL 368



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>BC036071-1|AAH36071.1|  366|Homo sapiens ELAVL4 protein protein.
          Length = 366

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.5 bits (93), Expect = 0.002
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++    +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVGQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAITSL 344

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 345 NG-YRLGDRVL 354


>BC030692-1|AAH30692.1|  346|Homo sapiens ELAVL2 protein protein.
          Length = 346

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D K  L V  L    +QE L+  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 35  EDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 95  KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 145



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 173



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  L+ +  +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 265 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 324

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 325 NG-YRLGDRVL 334



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 129 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174


>AY033998-1|AAK57541.1|  380|Homo sapiens HUDPRO1 protein.
          Length = 380

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 299 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 358

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 359 NG-YRLGDRVL 368



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AY033997-1|AAK57540.1|  366|Homo sapiens HUD1 protein.
          Length = 366

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 344

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 345 NG-YRLGDRVL 354



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AY033996-1|AAK57539.1|  383|Homo sapiens HUD4 protein.
          Length = 383

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 59  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 118

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 119 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 169



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 151 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 197



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 302 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 361

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 362 NG-YRLGDRVL 371



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 153 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 198


>AY033995-1|AAK57538.1|  366|Homo sapiens HUD3 protein.
          Length = 366

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 344

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 345 NG-YRLGDRVL 354



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AL592182-6|CAI15792.1|  385|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 385

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 47  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 106

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 107 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 157



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 139 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 185



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 304 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 363

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 364 NG-YRLGDRVL 373



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 141 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 186


>AL592182-5|CAI15793.1|  371|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 371

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 47  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 106

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 107 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 157



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 139 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 185



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 290 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 349

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 350 NG-YRLGDRVL 359



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 141 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 186


>AL592182-4|CAI15791.1|  380|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 380

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 299 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 358

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 359 NG-YRLGDRVL 368



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AL592182-3|CAI15790.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 344

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 345 NG-YRLGDRVL 354



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AL592182-2|CAI15789.1|  383|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 383

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 59  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 118

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 119 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 169



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 151 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 197



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 302 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 361

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 362 NG-YRLGDRVL 371



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 153 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 198


>AL592182-1|CAI15788.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 344

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 345 NG-YRLGDRVL 354



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AL583843-6|CAI14638.1|  385|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 385

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 47  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 106

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 107 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 157



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 139 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 185



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 304 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 363

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 364 NG-YRLGDRVL 373



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 141 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 186


>AL583843-5|CAI14639.1|  371|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 371

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 47  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 106

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 107 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 157



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 139 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 185



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 290 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 349

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 350 NG-YRLGDRVL 359



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 141 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 186


>AL583843-4|CAI14637.1|  380|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 380

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 299 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 358

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 359 NG-YRLGDRVL 368



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AL583843-3|CAI14636.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 344

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 345 NG-YRLGDRVL 354



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AL583843-2|CAI14635.1|  383|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 383

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 59  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 118

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 119 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 169



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 151 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 197



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 302 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 361

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 362 NG-YRLGDRVL 371



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 153 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 198


>AL583843-1|CAI14634.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 52/115 (45%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +QE  +  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 42  DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 101

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 102 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 152



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 134 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 180



 Score = 33.5 bits (73), Expect = 0.57
 Identities = 20/71 (28%), Positives = 39/71 (54%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  LS ++ +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 285 IFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 344

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 345 NG-YRLGDRVL 354



 Score = 29.9 bits (64), Expect = 7.0
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 136 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181


>AL161628-4|CAI13378.1|  387|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 387

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D K  L V  L    +QE L+  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 63  EDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 122

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 123 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 173



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 155 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 201



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  L+ +  +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 306 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 365

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 366 NG-YRLGDRVL 375



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 157 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 202


>AL161628-3|CAI13377.1|  189|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 189

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D K  L V  L    +QE L+  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 35  EDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 95  KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 145



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 173



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 129 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174


>AL161628-2|CAC22160.1|  359|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 359

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D K  L V  L    +QE L+  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 35  EDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 95  KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 145



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 173



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  L+ +  +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 278 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 337

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 338 NG-YRLGDRVL 347



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 129 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174


>AL161628-1|CAI13376.1|  346|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 346

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D K  L V  L    +QE L+  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 35  EDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 95  KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 145



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 173



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  L+ +  +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 265 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 324

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 325 NG-YRLGDRVL 334



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 129 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174


>AB209294-1|BAD92531.1|  367|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B) vari
           protein.
          Length = 367

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 29/115 (25%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D K  L V  L    +QE L+  F   GE+  C ++++  +G+S G+GFV + DP    
Sbjct: 43  EDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAE 102

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +T+ +L  +F
Sbjct: 103 KAI----NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLF 153



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    +Q+ L++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 135 LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRF 181



 Score = 32.7 bits (71), Expect = 0.99
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  L+ +  +  L + F  +G V +  V+++  + + +GFGFVT    D + + +   
Sbjct: 286 IFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASL 345

Query: 266 NGPHQLDGRTI 298
           NG ++L  R +
Sbjct: 346 NG-YRLGDRVL 355



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 13/46 (28%), Positives = 25/46 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  +T+ +      F +YG+++   I+ DQ    S G GF+ F+
Sbjct: 137 VSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 182


>L10911-1|AAA16347.1|  530|Homo sapiens splicing factor protein.
          Length = 530

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G +    +M +SE+GRS+G+GF+TF+D       L+ 
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ 310

Query: 266 -NGPHQLDGRTIDPKPCNPRT 325
            NG  +L GR +       RT
Sbjct: 311 LNG-FELAGRPMKVGHVTERT 330



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +2

Query: 131 NLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTI---- 298
           +L+ +FS  G+V D  ++ +  S RS+G  +V F D S V L +     ++ G  I    
Sbjct: 168 DLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQA 227

Query: 299 ---DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +            K   G  ++++G L  N+TE  LR IF
Sbjct: 228 SQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIF 270



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +G++  + +M D    +S G GF++F D
Sbjct: 250 MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD 300


>L10910-1|AAA16346.1|  524|Homo sapiens splicing factor protein.
          Length = 524

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G +    +M +SE+GRS+G+GF+TF+D       L+ 
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ 310

Query: 266 -NGPHQLDGRTIDPKPCNPRT 325
            NG  +L GR +       RT
Sbjct: 311 LNG-FELAGRPMKVGHVTERT 330



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +2

Query: 131 NLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTI---- 298
           +L+ +FS  G+V D  ++ +  S RS+G  +V F D S V L +     ++ G  I    
Sbjct: 168 DLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQA 227

Query: 299 ---DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +            K   G  ++++G L  N+TE  LR IF
Sbjct: 228 SQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIF 270



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +G++  + +M D    +S G GF++F D
Sbjct: 250 MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD 300


>BX537770-1|CAD97833.1|  373|Homo sapiens hypothetical protein
           protein.
          Length = 373

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G +    +M +SE+GRS+G+GF+TF+D       L+ 
Sbjct: 94  RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ 153

Query: 266 -NGPHQLDGRTIDPKPCNPRT 325
            NG  +L GR +       RT
Sbjct: 154 LNG-FELAGRPMKVGHVTERT 173



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +2

Query: 131 NLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTI---- 298
           +L+ +FS  G+V D  ++ +  S RS+G  +V F D S V L +     ++ G  I    
Sbjct: 11  DLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQA 70

Query: 299 ---DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +            K   G  ++++G L  N+TE  LR IF
Sbjct: 71  SQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIF 113



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +G++  + +M D    +S G GF++F D
Sbjct: 93  MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD 143


>BC141835-1|AAI41836.1|  530|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 530

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G +    +M +SE+GRS+G+GF+TF+D       L+ 
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ 310

Query: 266 -NGPHQLDGRTIDPKPCNPRT 325
            NG  +L GR +       RT
Sbjct: 311 LNG-FELAGRPMKVGHVTERT 330



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +2

Query: 131 NLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTI---- 298
           +L+ +FS  G+V D  ++ +  S RS+G  +V F D S V L +     ++ G  I    
Sbjct: 168 DLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQA 227

Query: 299 ---DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +            K   G  ++++G L  N+TE  LR IF
Sbjct: 228 SQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIF 270



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +G++  + +M D    +S G GF++F D
Sbjct: 250 MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD 300


>BC131543-1|AAI31544.1|  508|Homo sapiens RBM39 protein protein.
          Length = 508

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G +    +M +SE+GRS+G+GF+TF+D       L+ 
Sbjct: 229 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ 288

Query: 266 -NGPHQLDGRTIDPKPCNPRT 325
            NG  +L GR +       RT
Sbjct: 289 LNG-FELAGRPMKVGHVTERT 308



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +2

Query: 131 NLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTI---- 298
           +L+ +FS  G+V D  ++ +  S RS+G  +V F D S V L +     ++ G  I    
Sbjct: 146 DLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQA 205

Query: 299 ---DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +            K   G  ++++G L  N+TE  LR IF
Sbjct: 206 SQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIF 248



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +G++  + +M D    +S G GF++F D
Sbjct: 228 MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD 278


>AL357374-9|CAC11119.1|  524|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 524

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G +    +M +SE+GRS+G+GF+TF+D       L+ 
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ 310

Query: 266 -NGPHQLDGRTIDPKPCNPRT 325
            NG  +L GR +       RT
Sbjct: 311 LNG-FELAGRPMKVGHVTERT 330



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +2

Query: 131 NLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTI---- 298
           +L+ +FS  G+V D  ++ +  S RS+G  +V F D S V L +     ++ G  I    
Sbjct: 168 DLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQA 227

Query: 299 ---DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +            K   G  ++++G L  N+TE  LR IF
Sbjct: 228 SQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIF 270



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +G++  + +M D    +S G GF++F D
Sbjct: 250 MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD 300


>AL357374-8|CAC11118.1|  530|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 530

 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +L+VG L +  +++ L+  F  +G +    +M +SE+GRS+G+GF+TF+D       L+ 
Sbjct: 251 RLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQ 310

Query: 266 -NGPHQLDGRTIDPKPCNPRT 325
            NG  +L GR +       RT
Sbjct: 311 LNG-FELAGRPMKVGHVTERT 330



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +2

Query: 131 NLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTI---- 298
           +L+ +FS  G+V D  ++ +  S RS+G  +V F D S V L +     ++ G  I    
Sbjct: 168 DLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQA 227

Query: 299 ---DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
              +            K   G  ++++G L  N+TE  LR IF
Sbjct: 228 SQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIF 270



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +3

Query: 357 LRCSLAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +R  +   H  + + +    F  +G++  + +M D    +S G GF++F D
Sbjct: 250 MRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD 300


>BC015944-1|AAH15944.1|  214|Homo sapiens TIA1 protein protein.
          Length = 214

 Score = 50.8 bits (116), Expect = 3e-06
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQN 268
           +FVG LS E + E+++  F+ +G + D  V+K+  +G+S+G+GFV+F +     N + Q 
Sbjct: 108 VFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQM 167

Query: 269 GPHQLDGRTI 298
           G   L GR I
Sbjct: 168 GGQWLGGRQI 177



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 28/129 (21%), Positives = 58/129 (44%), Gaps = 12/129 (9%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD--P 241
           M+D+    L+VG LS + ++  + + FS+ G   +C ++   ++  +  + FV F +   
Sbjct: 1   MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMI--MDTAGNDPYCFVEFHEHRH 58

Query: 242 SLVNLVLQNGPHQLDGRTI----------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNV 391
           +   L   NG  ++ G+ +            K  +  T+   +R   +  VF+G L   +
Sbjct: 59  AAAALAAMNG-RKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEI 117

Query: 392 TETDLRXIF 418
           T  D++  F
Sbjct: 118 TTEDIKAAF 126


>AB209211-1|BAD92448.1|  464|Homo sapiens TIA1 protein variant
           protein.
          Length = 464

 Score = 50.8 bits (116), Expect = 3e-06
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQN 268
           +FVG LS E + E+++  F+ +G + D  V+K+  +G+S+G+GFV+F +     N + Q 
Sbjct: 146 VFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQM 205

Query: 269 GPHQLDGRTI 298
           G   L GR I
Sbjct: 206 GGQWLGGRQI 215



 Score = 29.5 bits (63), Expect = 9.2
 Identities = 28/129 (21%), Positives = 58/129 (44%), Gaps = 12/129 (9%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD--P 241
           M+D+    L+VG LS + ++  + + FS+ G   +C ++   ++  +  + FV F +   
Sbjct: 39  MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMI--MDTAGNDPYCFVEFHEHRH 96

Query: 242 SLVNLVLQNGPHQLDGRTI----------DPKPCNPRTLQKPKRGGGYPKVFLGGLPSNV 391
           +   L   NG  ++ G+ +            K  +  T+   +R   +  VF+G L   +
Sbjct: 97  AAAALAAMNG-RKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEI 155

Query: 392 TETDLRXIF 418
           T  D++  F
Sbjct: 156 TTEDIKAAF 164


>M96954-1|AAA36384.1|  375|Homo sapiens nucleolysin TIAR protein.
          Length = 375

 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 25/70 (35%), Positives = 44/70 (62%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQN 268
           +FVG LS E + E+++  F+ +G++ D  V+K+  +G+S+G+GFV+F +     N ++  
Sbjct: 99  VFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHM 158

Query: 269 GPHQLDGRTI 298
           G   L GR I
Sbjct: 159 GGQWLGGRQI 168


>D64015-1|BAA21559.1|  265|Homo sapiens T-cluster binding protein
           protein.
          Length = 265

 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 25/70 (35%), Positives = 44/70 (62%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQN 268
           +FVG LS E + E+++  F+ +G++ D  V+K+  +G+S+G+GFV+F +     N ++  
Sbjct: 60  VFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHM 119

Query: 269 GPHQLDGRTI 298
           G   L GR I
Sbjct: 120 GGQWLGGRQI 129


>AY633610-1|AAV33303.1|  374|Homo sapiens aging-associated gene 7
           protein protein.
          Length = 374

 Score = 50.4 bits (115), Expect = 5e-06
 Identities = 25/70 (35%), Positives = 44/70 (62%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP-SLVNLVLQN 268
           +FVG LS E + E+++  F+ +G++ D  V+K+  +G+S+G+GFV+F +     N ++  
Sbjct: 99  VFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHM 158

Query: 269 GPHQLDGRTI 298
           G   L GR I
Sbjct: 159 GGQWLGGRQI 168


>U53209-1|AAC50658.1|  282|Homo sapiens transformer-2 alpha protein.
          Length = 282

 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 36/86 (41%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FSRYG +    V+ +  +GRSRGF FV
Sbjct: 110 GSRANPDPNTC----LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFV 165

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D S   +   NG  +LDGR I
Sbjct: 166 YFERIDDSKEAMERANG-MELDGRRI 190



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           F RYG +  V ++YDQ   +S G  F+ FE
Sbjct: 139 FSRYGPLSGVNVVYDQRTGRSRGFAFVYFE 168


>BC017094-1|AAH17094.1|  282|Homo sapiens transformer-2 alpha
           protein.
          Length = 282

 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 36/86 (41%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FSRYG +    V+ +  +GRSRGF FV
Sbjct: 110 GSRANPDPNTC----LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFV 165

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D S   +   NG  +LDGR I
Sbjct: 166 YFERIDDSKEAMERANG-MELDGRRI 190



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           F RYG +  V ++YDQ   +S G  F+ FE
Sbjct: 139 FSRYGPLSGVNVVYDQRTGRSRGFAFVYFE 168


>AC023105-1|AAQ96870.1|  282|Homo sapiens unknown protein.
          Length = 282

 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 36/86 (41%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FSRYG +    V+ +  +GRSRGF FV
Sbjct: 110 GSRANPDPNTC----LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFV 165

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D S   +   NG  +LDGR I
Sbjct: 166 YFERIDDSKEAMERANG-MELDGRRI 190



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           F RYG +  V ++YDQ   +S G  F+ FE
Sbjct: 139 FSRYGPLSGVNVVYDQRTGRSRGFAFVYFE 168


>AB097048-1|BAC77401.1|  282|Homo sapiens putative MAPK activating
           protein protein.
          Length = 282

 Score = 50.0 bits (114), Expect = 6e-06
 Identities = 36/86 (41%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FSRYG +    V+ +  +GRSRGF FV
Sbjct: 110 GSRANPDPNTC----LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFV 165

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D S   +   NG  +LDGR I
Sbjct: 166 YFERIDDSKEAMERANG-MELDGRRI 190



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           F RYG +  V ++YDQ   +S G  F+ FE
Sbjct: 139 FSRYGPLSGVNVVYDQRTGRSRGFAFVYFE 168


>BC105582-1|AAI05583.1|  173|Homo sapiens RBMX2 protein protein.
          Length = 173

 Score = 49.6 bits (113), Expect = 8e-06
 Identities = 22/70 (31%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           +F+GGL +E ++ ++   FS+YGE+++  ++++ ++G+S+GF F+ + D     L + N 
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNF 97

Query: 269 GPHQLDGRTI 298
              ++ GRTI
Sbjct: 98  NGIKIKGRTI 107



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++ + ++ D+   KS G  FL +ED+ S
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89


>BC033750-1|AAH33750.1|  322|Homo sapiens RNA binding motif protein,
           X-linked 2 protein.
          Length = 322

 Score = 49.6 bits (113), Expect = 8e-06
 Identities = 22/70 (31%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           +F+GGL +E ++ ++   FS+YGE+++  ++++ ++G+S+GF F+ + D     L + N 
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNF 97

Query: 269 GPHQLDGRTI 298
              ++ GRTI
Sbjct: 98  NGIKIKGRTI 107



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++ + ++ D+   KS G  FL +ED+ S
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89


>BC003676-1|AAH03676.1|  163|Homo sapiens Unknown (protein for
           IMAGE:3686686) protein.
          Length = 163

 Score = 49.6 bits (113), Expect = 8e-06
 Identities = 22/70 (31%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           +F+GGL +E ++ ++   FS+YGE+++  ++++ ++G+S+GF F+ + D     L + N 
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNF 97

Query: 269 GPHQLDGRTI 298
              ++ GRTI
Sbjct: 98  NGIKIKGRTI 107



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++ + ++ D+   KS G  FL +ED+ S
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89


>AL050405-1|CAB43745.1|  322|Homo sapiens hypothetical protein
           protein.
          Length = 322

 Score = 49.6 bits (113), Expect = 8e-06
 Identities = 22/70 (31%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           +F+GGL +E ++ ++   FS+YGE+++  ++++ ++G+S+GF F+ + D     L + N 
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNF 97

Query: 269 GPHQLDGRTI 298
              ++ GRTI
Sbjct: 98  NGIKIKGRTI 107



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++ + ++ D+   KS G  FL +ED+ S
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89


>AL035423-8|CAI42444.1|  322|Homo sapiens RNA binding motif protein,
           X-linked 2 protein.
          Length = 322

 Score = 49.6 bits (113), Expect = 8e-06
 Identities = 22/70 (31%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           +F+GGL +E ++ ++   FS+YGE+++  ++++ ++G+S+GF F+ + D     L + N 
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNF 97

Query: 269 GPHQLDGRTI 298
              ++ GRTI
Sbjct: 98  NGIKIKGRTI 107



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++ + ++ D+   KS G  FL +ED+ S
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89


>AF151837-1|AAD34074.1|  351|Homo sapiens CGI-79 protein protein.
          Length = 351

 Score = 49.6 bits (113), Expect = 8e-06
 Identities = 22/70 (31%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           +F+GGL +E ++ ++   FS+YGE+++  ++++ ++G+S+GF F+ + D     L + N 
Sbjct: 38  IFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNF 97

Query: 269 GPHQLDGRTI 298
              ++ GRTI
Sbjct: 98  NGIKIKGRTI 107



 Score = 31.1 bits (67), Expect = 3.0
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           F +YG+++ + ++ D+   KS G  FL +ED+ S
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRS 89


>BC028101-1|AAH28101.1|  485|Homo sapiens bruno-like 5, RNA binding
           protein (Drosophila) protein.
          Length = 485

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 1/121 (0%)
 Frame = +2

Query: 62  PD-MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           PD M D +  KLFVG +     +++L+  F ++G + +  V+K+  +G  +G  F+T+  
Sbjct: 36  PDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCA 95

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
                +  Q   H+        +P   +      RGG   K+F+G L    +E D+  +F
Sbjct: 96  RDSA-IKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLF 154

Query: 419 R 421
           +
Sbjct: 155 Q 155



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           KLFVG L+ + S+E++ R F  +G + +C V++  + G S+G  FV F+
Sbjct: 135 KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPD-GSSKGCAFVKFS 182


>AF329266-1|AAK07476.1|  481|Homo sapiens CUG-BP and ETR-3 like
           factor 5 protein.
          Length = 481

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 1/121 (0%)
 Frame = +2

Query: 62  PD-MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           PD M D +  KLFVG +     +++L+  F ++G + +  V+K+  +G  +G  F+T+  
Sbjct: 36  PDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCA 95

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
                +  Q   H+        +P   +      RGG   K+F+G L    +E D+  +F
Sbjct: 96  RDSA-IKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLF 154

Query: 419 R 421
           +
Sbjct: 155 Q 155



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           KLFVG L+ + S+E++ R F  +G + +C V++  + G S+G  FV F+
Sbjct: 135 KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPD-GSSKGCAFVKFS 182


>AB210019-1|BAE06101.1|  544|Homo sapiens CUGBP1 variant protein
           protein.
          Length = 544

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG--RSRGFGFVTF 232
           +PD  D +  K+FVG +    S+++L+  F +YG V +  V+++      +S+G  FVTF
Sbjct: 66  HPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTF 125

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  L  QN  H +        P   +     K      K+F+G +    TE D+R 
Sbjct: 126 YTRKAA-LEAQNALHNMKVLPGMHHPIQMKPADSEKNNVEDRKLFIGMISKKCTENDIRV 184

Query: 413 IF 418
           +F
Sbjct: 185 MF 186


>AB209067-1|BAD92304.1|  421|Homo sapiens bruno-like 5, RNA binding
           protein variant protein.
          Length = 421

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 1/121 (0%)
 Frame = +2

Query: 62  PD-MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           PD M D +  KLFVG +     +++L+  F ++G + +  V+K+  +G  +G  F+T+  
Sbjct: 48  PDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCA 107

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
                +  Q   H+        +P   +      RGG   K+F+G L    +E D+  +F
Sbjct: 108 RDSA-IKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLF 166

Query: 419 R 421
           +
Sbjct: 167 Q 167



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           KLFVG L+ + S+E++ R F  +G + +C V++  + G S+G  FV F+
Sbjct: 147 KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPD-GSSKGCAFVKFS 194


>D26158-1|BAA21838.1|  350|Homo sapiens PLE21 protein protein.
          Length = 350

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 25/115 (21%), Positives = 55/115 (47%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +Q+  +  F   G++  C ++++  +G+S G+GFV ++DP+  +
Sbjct: 26  DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDAD 85

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +++ ++  +F
Sbjct: 86  KAI----NTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLF 136



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    SQ+ +++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 118 LYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 164



 Score = 33.9 bits (74), Expect = 0.43
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FV  LS E  Q  L + F  +G V +  V+++  + + +GFGF+T  +
Sbjct: 269 IFVYNLSPEPDQSVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFMTMTN 317



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 276 INLMAGPSTLSRAILALF-KNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVI 452
           IN + G    ++ I   + +  + ++      ++G  +T+ +      F +YG+++   I
Sbjct: 88  INTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRI 147

Query: 453 MYDQXKKKSXGXGFLSFE 506
           + DQ    S G GF+ F+
Sbjct: 148 LVDQVTGVSRGVGFIRFD 165


>BC066549-1|AAH66549.1|  474|Homo sapiens RNA binding motif protein
           45 protein.
          Length = 474

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 23/81 (28%), Positives = 44/81 (54%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D++D+E  ++FV  +    ++E+L+  F  YG++  C ++KN  +G S+G G+V +  PS
Sbjct: 114 DVEDEELTRIFVM-IPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPS 172

Query: 245 LVNLVLQNGPHQLDGRTIDPK 307
                ++N          +PK
Sbjct: 173 QAAQAIENCDRSFRAILAEPK 193


>BC026077-1|AAH26077.1|  161|Homo sapiens RBMY2FP protein protein.
          Length = 161

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 27/96 (28%), Positives = 53/96 (55%), Gaps = 1/96 (1%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GK F+GGL+ E +++  +  F+++G + + +++K+  S +SRGF F TF + + 
Sbjct: 2   VEADRPGKHFIGGLNRENNEKMFKAVFAKHGPISEVLLIKDRTS-KSRGFAFTTFENTA- 59

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPK-RGGG 352
                +N    + G+ +D K       +KP  + GG
Sbjct: 60  ---DAKNAAKHMIGKPLDGKAIKVEQAKKPSFQSGG 92


>BC014144-1|AAH14144.1|  367|Homo sapiens ELAVL3 protein protein.
          Length = 367

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 25/115 (21%), Positives = 55/115 (47%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +Q+  +  F   G++  C ++++  +G+S G+GFV ++DP+  +
Sbjct: 35  DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDAD 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +++ ++  +F
Sbjct: 95  KAI----NTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLF 145



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    SQ+ +++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 173



 Score = 34.3 bits (75), Expect = 0.32
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FV  LS E  +  L + F  +G V +  V+++  + + +GFGFVT  +
Sbjct: 286 IFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTN 334



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 276 INLMAGPSTLSRAILALF-KNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVI 452
           IN + G    ++ I   + +  + ++      ++G  +T+ +      F +YG+++   I
Sbjct: 97  INTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRI 156

Query: 453 MYDQXKKKSXGXGFLSFE 506
           + DQ    S G GF+ F+
Sbjct: 157 LVDQVTGVSRGVGFIRFD 174


>AF526533-1|AAM88417.1|  328|Homo sapiens putative RNA binding
           protein RB-1 protein.
          Length = 328

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 23/81 (28%), Positives = 44/81 (54%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D++D+E  ++FV  +    ++E+L+  F  YG++  C ++KN  +G S+G G+V +  PS
Sbjct: 114 DVEDEELTRIFVM-IPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPS 172

Query: 245 LVNLVLQNGPHQLDGRTIDPK 307
                ++N          +PK
Sbjct: 173 QAAQAIENCDRSFRAILAEPK 193


>AB036991-1|BAC16207.1|  476|Homo sapiens developmentally regulated
           RNA-binding protein 1 protein.
          Length = 476

 Score = 48.8 bits (111), Expect = 1e-05
 Identities = 23/81 (28%), Positives = 44/81 (54%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D++D+E  ++FV  +    ++E+L+  F  YG++  C ++KN  +G S+G G+V +  PS
Sbjct: 114 DVEDEELTRIFVM-IPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPS 172

Query: 245 LVNLVLQNGPHQLDGRTIDPK 307
                ++N          +PK
Sbjct: 173 QAAQAIENCDRSFRAILAEPK 193


>AK096015-1|BAC04674.1|  378|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38696 fis, clone KIDNE2001931, highly similar to
           HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN G. ).
          Length = 378

 Score = 48.4 bits (110), Expect = 2e-05
 Identities = 18/44 (40%), Positives = 33/44 (75%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSES 199
           ++ D  GKLF+GGL+ ET+++ L+  F +YG +++ ++MK+ ES
Sbjct: 2   VEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRES 45


>X03910-1|CAA27544.1|  225|Homo sapiens protein ( Human mRNA for
           hnRNP C protein cross-reacting with C1 and C2 hnRNP
           core proteins.  ).
          Length = 225

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 20/48 (41%), Positives = 33/48 (68%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           K+FVGGLS +T +E ++ YF  +GEV    +  ++++ + RGF F+TF
Sbjct: 173 KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITF 220


>U68063-1|AAB08701.1|  288|Homo sapiens transformer-2 beta protein.
          Length = 288

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 109 GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 164

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 165 YFENVDDAKEAKERANG-MELDGRRI 189



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 138 FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 168


>U61267-1|AAC28242.1|  288|Homo sapiens htra2-beta protein.
          Length = 288

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 109 GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 164

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 165 YFENVDDAKEAKERANG-MELDGRRI 189



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 138 FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 168


>L26405-1|AAA58677.1|  359|Homo sapiens huc protein.
          Length = 359

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 25/115 (21%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +Q+  +  F   G++  C ++++  +GR  G+GFV + DP+  +
Sbjct: 35  DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGRDLGYGFVNYPDPNDAD 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +++ ++  +F
Sbjct: 95  KAI----NTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLF 145



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    SQ+ +++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 173



 Score = 34.3 bits (75), Expect = 0.32
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FV  LS E  +  L + F  +G V +  V+++  + + +GFGFVT  +
Sbjct: 278 IFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTN 326



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 276 INLMAGPSTLSRAILALF-KNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVI 452
           IN + G    ++ I   + +  + ++      ++G  +T+ +      F +YG+++   I
Sbjct: 97  INTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRI 156

Query: 453 MYDQXKKKSXGXGFLSFE 506
           + DQ    S G GF+ F+
Sbjct: 157 LVDQVTGVSRGVGFIRFD 174


>BC031682-1|AAH31682.1|  450|Homo sapiens RBM42 protein protein.
          Length = 450

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 20/57 (35%), Positives = 36/57 (63%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D +  ++F G L  E + + L R FSR+   +   V+++  +G+++G+GFV+F DPS
Sbjct: 347 DADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPS 403


>BC005898-1|AAH05898.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 109 GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 164

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 165 YFENVDDAKEAKERANG-MELDGRRI 189



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 138 FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 168


>BC004204-1|AAH04204.1|  480|Homo sapiens hypothetical protein
           MGC10433 protein.
          Length = 480

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 20/57 (35%), Positives = 36/57 (63%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D +  ++F G L  E + + L R FSR+   +   V+++  +G+++G+GFV+F DPS
Sbjct: 377 DADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPS 433


>BC002868-1|AAH02868.1|  451|Homo sapiens MGC10433 protein protein.
          Length = 451

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 20/57 (35%), Positives = 36/57 (63%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D +  ++F G L  E + + L R FSR+   +   V+++  +G+++G+GFV+F DPS
Sbjct: 348 DADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPS 404


>BC000451-1|AAH00451.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 109 GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 164

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 165 YFENVDDAKEAKERANG-MELDGRRI 189



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 138 FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 168


>BC000160-1|AAH00160.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 109 GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 164

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 165 YFENVDDAKEAKERANG-MELDGRRI 189



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 138 FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 168


>AY036909-1|AAK67714.1|  360|Homo sapiens HUC protein.
          Length = 360

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 25/115 (21%), Positives = 53/115 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           DD K  L V  L    +Q+  +  F   G++  C ++++  +GR  G+GFV + DP+  +
Sbjct: 35  DDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGRDLGYGFVNYPDPNDAD 94

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
             +    + L+G  +  K       +          +++ GLP  +++ ++  +F
Sbjct: 95  KAI----NTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLF 145



 Score = 42.3 bits (95), Expect = 0.001
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           L+V GL    SQ+ +++ FS+YG +I   ++ +  +G SRG GF+ F
Sbjct: 127 LYVSGLPKTMSQKEMEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF 173



 Score = 34.3 bits (75), Expect = 0.32
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +FV  LS E  +  L + F  +G V +  V+++  + + +GFGFVT  +
Sbjct: 279 IFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTN 327



 Score = 30.7 bits (66), Expect = 4.0
 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 276 INLMAGPSTLSRAILALF-KNRNVAVDTLRCSLAGCHRTLPKPISGXFFGRYGKVMEVVI 452
           IN + G    ++ I   + +  + ++      ++G  +T+ +      F +YG+++   I
Sbjct: 97  INTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGRIITSRI 156

Query: 453 MYDQXKKKSXGXGFLSFE 506
           + DQ    S G GF+ F+
Sbjct: 157 LVDQVTGVSRGVGFIRFD 174


>AK098191-1|BAC05256.1|  252|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40872 fis, clone TUTER2000283, highly similar to
           Homo sapiens transformer-2-beta (SFRS10) gene. ).
          Length = 252

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 73  GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 128

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 129 YFENVDDAKEAKERANG-MELDGRRI 153



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 102 FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 132


>AF057159-3|AAD19278.1|  188|Homo sapiens transformer-2-beta isoform
           3 protein.
          Length = 188

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 9   GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 64

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 65  YFENVDDAKEAKERANG-MELDGRRI 89



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 38  FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 68


>AF057159-1|AAD19277.1|  288|Homo sapiens transformer-2-beta isoform
           1 protein.
          Length = 288

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 109 GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 164

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 165 YFENVDDAKEAKERANG-MELDGRRI 189



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 138 FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 168


>AC002115-1|AAB57629.1|  339|Homo sapiens F25451_2 protein.
          Length = 339

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 20/57 (35%), Positives = 36/57 (63%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D +  ++F G L  E + + L R FSR+   +   V+++  +G+++G+GFV+F DPS
Sbjct: 236 DADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPS 292


>AB209208-1|BAD92445.1|  278|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) va protein.
          Length = 278

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 34/86 (39%), Positives = 47/86 (54%), Gaps = 2/86 (2%)
 Frame = +2

Query: 47  GMRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           G R NPD +      L V GLS  T++ +L+  FS+YG + D  ++ + +S RSRGF FV
Sbjct: 97  GNRANPDPNCC----LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFV 152

Query: 227 TF--ADPSLVNLVLQNGPHQLDGRTI 298
            F   D +       NG  +LDGR I
Sbjct: 153 YFENVDDAKEAKERANG-MELDGRRI 177



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           F +YG + +V I+YDQ  ++S G  F+ FE+
Sbjct: 126 FSKYGPIADVSIVYDQQSRRSRGFAFVYFEN 156


>BC022543-1|AAH22543.1|  217|Homo sapiens zinc finger CCHC-type and
           RNA binding motif 1 protein.
          Length = 217

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLV 259
           K  ++V  L +  +  +L R FS+YG+V+   +MK+ ++ +S+G  F+ F D  S  N  
Sbjct: 9   KSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCT 68

Query: 260 LQNGPHQLDGRTI 298
                 QL GR I
Sbjct: 69  RAINNKQLFGRVI 81


>BC010177-1|AAH10177.1|  140|Homo sapiens ZCRB1 protein protein.
          Length = 140

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLV 259
           K  ++V  L +  +  +L R FS+YG+V+   +MK+ ++ +S+G  F+ F D  S  N  
Sbjct: 9   KSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCT 68

Query: 260 LQNGPHQLDGRTI 298
                 QL GR I
Sbjct: 69  RAINNKQLFGRVI 81


>BC005099-1|AAH05099.1|  141|Homo sapiens Unknown (protein for
           IMAGE:3609027) protein.
          Length = 141

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLV 259
           K  ++V  L +  +  +L R FS+YG+V+   +MK+ ++ +S+G  F+ F D  S  N  
Sbjct: 9   KSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCT 68

Query: 260 LQNGPHQLDGRTI 298
                 QL GR I
Sbjct: 69  RAINNKQLFGRVI 81


>AB062361-1|BAB56132.1|  217|Homo sapiens ZCRB1 protein protein.
          Length = 217

 Score = 47.6 bits (108), Expect = 3e-05
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD-PSLVNLV 259
           K  ++V  L +  +  +L R FS+YG+V+   +MK+ ++ +S+G  F+ F D  S  N  
Sbjct: 9   KSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCT 68

Query: 260 LQNGPHQLDGRTI 298
                 QL GR I
Sbjct: 69  RAINNKQLFGRVI 81


>BC047522-1|AAH47522.1|  402|Homo sapiens BRUNOL5 protein protein.
          Length = 402

 Score = 46.8 bits (106), Expect = 6e-05
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 62  PD-MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           PD M D +  KLFVG +     +++L+    ++G + +  V+K+  +G  +G  F+T+  
Sbjct: 36  PDGMKDLDAIKLFVGQIPRHLDEKDLKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCA 95

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
                +  Q   H+        +P   +      RGG   K+F+G L    +E D+  +F
Sbjct: 96  RDSA-IKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLF 154

Query: 419 R 421
           +
Sbjct: 155 Q 155



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           KLFVG L+ + S+E++ R F  +G + +C V++  + G S+G  FV F+
Sbjct: 135 KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPD-GSSKGCAFVKFS 182


>U63289-1|AAC50895.1|  482|Homo sapiens CUG-BP/hNab50 protein.
          Length = 482

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 3/123 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG--RSRGFGFVTF 232
           +PD  D +  K+FVG +    S+++L+  F +YG V +  V+++      +S+G  FVTF
Sbjct: 7   HPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTF 66

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLR 409
                  L  QN  H +        P   +     K       K+F+G +    TE D+R
Sbjct: 67  YTRKAA-LEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIR 125

Query: 410 XIF 418
            +F
Sbjct: 126 VMF 128


>BC031079-1|AAH31079.1|  483|Homo sapiens CUG triplet repeat, RNA
           binding protein 1 protein.
          Length = 483

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 3/123 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG--RSRGFGFVTF 232
           +PD  D +  K+FVG +    S+++L+  F +YG V +  V+++      +S+G  FVTF
Sbjct: 7   HPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTF 66

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLR 409
                  L  QN  H +        P   +     K       K+F+G +    TE D+R
Sbjct: 67  YTRKAA-LEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIR 125

Query: 410 XIF 418
            +F
Sbjct: 126 VMF 128


>BC017895-1|AAH17895.1|  109|Homo sapiens chromosome 14 open reading
           frame 156 protein.
          Length = 109

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/79 (27%), Positives = 39/79 (49%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           FV  + W  +   L+ +F+++G V  C++  + E+G  RG G+V F+    +   LQ   
Sbjct: 22  FVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQEN 81

Query: 275 HQLDGRTIDPKPCNPRTLQ 331
           H +DG  +      P+  Q
Sbjct: 82  HIIDGVKVQVHTRRPKLPQ 100


>AY860853-1|AAX58600.1|  109|Homo sapiens SRA stem-loop-interacting
           RNA-binding protein protein.
          Length = 109

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/79 (27%), Positives = 39/79 (49%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           FV  + W  +   L+ +F+++G V  C++  + E+G  RG G+V F+    +   LQ   
Sbjct: 22  FVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQEN 81

Query: 275 HQLDGRTIDPKPCNPRTLQ 331
           H +DG  +      P+  Q
Sbjct: 82  HIIDGVKVQVHTRRPKLPQ 100


>AJ272055-1|CAC81241.1|  109|Homo sapiens hypothetical protein
           protein.
          Length = 109

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/79 (27%), Positives = 39/79 (49%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           FV  + W  +   L+ +F+++G V  C++  + E+G  RG G+V F+    +   LQ   
Sbjct: 22  FVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQEN 81

Query: 275 HQLDGRTIDPKPCNPRTLQ 331
           H +DG  +      P+  Q
Sbjct: 82  HIIDGVKVQVHTRRPKLPQ 100


>AJ007988-1|CAC20566.1|  486|Homo sapiens deadenylation factor
           CUG-BP protein.
          Length = 486

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 3/123 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG--RSRGFGFVTF 232
           +PD  D +  K+FVG +    S+++L+  F +YG V +  V+++      +S+G  FVTF
Sbjct: 7   HPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTF 66

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLR 409
                  L  QN  H +        P   +     K       K+F+G +    TE D+R
Sbjct: 67  YTRKAA-LEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIR 125

Query: 410 XIF 418
            +F
Sbjct: 126 VMF 128


>AF271779-1|AAG44790.1|  109|Homo sapiens DC50 protein.
          Length = 109

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/79 (27%), Positives = 39/79 (49%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           FV  + W  +   L+ +F+++G V  C++  + E+G  RG G+V F+    +   LQ   
Sbjct: 22  FVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQEN 81

Query: 275 HQLDGRTIDPKPCNPRTLQ 331
           H +DG  +      P+  Q
Sbjct: 82  HIIDGVKVQVHTRRPKLPQ 100


>AF267534-1|AAF78956.1|  483|Homo sapiens CUG-binding protein A
           isoform protein.
          Length = 483

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 3/123 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG--RSRGFGFVTF 232
           +PD  D +  K+FVG +    S+++L+  F +YG V +  V+++      +S+G  FVTF
Sbjct: 7   HPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTF 66

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLR 409
                  L  QN  H +        P   +     K       K+F+G +    TE D+R
Sbjct: 67  YTRKAA-LEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIR 125

Query: 410 XIF 418
            +F
Sbjct: 126 VMF 128


>AF267533-1|AAF78955.1|  486|Homo sapiens CUG-binding protein LYLQ
           isoform protein.
          Length = 486

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 3/123 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG--RSRGFGFVTF 232
           +PD  D +  K+FVG +    S+++L+  F +YG V +  V+++      +S+G  FVTF
Sbjct: 7   HPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTF 66

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLR 409
                  L  QN  H +        P   +     K       K+F+G +    TE D+R
Sbjct: 67  YTRKAA-LEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIR 125

Query: 410 XIF 418
            +F
Sbjct: 126 VMF 128


>AF253980-1|AAG44629.1|  109|Homo sapiens DC23 protein.
          Length = 109

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 22/79 (27%), Positives = 39/79 (49%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGP 274
           FV  + W  +   L+ +F+++G V  C++  + E+G  RG G+V F+    +   LQ   
Sbjct: 22  FVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQEN 81

Query: 275 HQLDGRTIDPKPCNPRTLQ 331
           H +DG  +      P+  Q
Sbjct: 82  HIIDGVKVQVHTRRPKLPQ 100


>AF248648-1|AAF86230.1|  486|Homo sapiens RNA-binding protein
           BRUNOL2 protein.
          Length = 486

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 3/123 (2%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG--RSRGFGFVTF 232
           +PD  D +  K+FVG +    S+++L+  F +YG V +  V+++      +S+G  FVTF
Sbjct: 7   HPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTF 66

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLR 409
                  L  QN  H +        P   +     K       K+F+G +    TE D+R
Sbjct: 67  YTRKAA-LEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIR 125

Query: 410 XIF 418
            +F
Sbjct: 126 VMF 128


>AF026564-1|AAC16916.1|  318|Homo sapiens RNA binding protein
           protein.
          Length = 318

 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 25/95 (26%), Positives = 53/95 (55%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           ++ D  GKLF+GGL+ E +++ L+  F+++G +++ +++K   S +SR F  + F + + 
Sbjct: 2   VEADCHGKLFIGGLNREANEKVLKEVFAKHGPLLEVLLIKGRTS-KSRDFVVIIFENAA- 59

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
                +N    ++G+++D K       +KP    G
Sbjct: 60  ---DAKNAARDMNGKSLDGKEIKVEQAKKPSFPSG 91


>BC006137-1|AAH06137.1|  960|Homo sapiens RBM19 protein protein.
          Length = 960

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 36/126 (28%), Positives = 55/126 (43%), Gaps = 12/126 (9%)
 Frame = +2

Query: 92   LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG---RSRGFGFVTFADPSLVNLVL 262
            LF+  L+++T++E L+  FS+ G V  C + K         S GFGFV +  P      L
Sbjct: 732  LFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKAL 791

Query: 263  -QNGPHQLDGR----TIDPKPCNPR-TLQKPK---RGGGYPKVFLGGLPSNVTETDLRXI 415
             Q   H +DG      I  +   P  TL + K   R     K+ +  +P      ++R +
Sbjct: 792  KQLQGHVVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIPFQAHSREIREL 851

Query: 416  FRTLWE 433
            F T  E
Sbjct: 852  FSTFGE 857



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 19/54 (35%), Positives = 35/54 (64%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           E G+LFV  L + +++E+L++ FS+YG + +     +S + + +GF F+TF  P
Sbjct: 400 ESGRLFVRNLPYTSTEEDLEKLFSKYGPLSELHYPIDSLTKKPKGFAFITFMFP 453



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKN-SESGRSRGFGFVTF 232
           K+ V  + ++     ++  FS +GE+    + K  + +G  RGFGFV F
Sbjct: 833 KILVRNIPFQAHSREIRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDF 881


>BC004289-1|AAH04289.1|  960|Homo sapiens RBM19 protein protein.
          Length = 960

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 36/126 (28%), Positives = 55/126 (43%), Gaps = 12/126 (9%)
 Frame = +2

Query: 92   LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG---RSRGFGFVTFADPSLVNLVL 262
            LF+  L+++T++E L+  FS+ G V  C + K         S GFGFV +  P      L
Sbjct: 732  LFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKAL 791

Query: 263  -QNGPHQLDGR----TIDPKPCNPR-TLQKPK---RGGGYPKVFLGGLPSNVTETDLRXI 415
             Q   H +DG      I  +   P  TL + K   R     K+ +  +P      ++R +
Sbjct: 792  KQLQGHVVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIPFQAHSREIREL 851

Query: 416  FRTLWE 433
            F T  E
Sbjct: 852  FSTFGE 857



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 19/54 (35%), Positives = 35/54 (64%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           E G+LFV  L + +++E+L++ FS+YG + +     +S + + +GF F+TF  P
Sbjct: 400 ESGRLFVRNLPYTSTEEDLEKLFSKYGPLSELHYPIDSLTKKPKGFAFITFMFP 453



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKN-SESGRSRGFGFVTF 232
           K+ V  + ++     ++  FS +GE+    + K  + +G  RGFGFV F
Sbjct: 833 KILVRNIPFQAHSREIRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDF 881


>AB014582-1|BAA31657.2|  973|Homo sapiens KIAA0682 protein protein.
          Length = 973

 Score = 45.6 bits (103), Expect = 1e-04
 Identities = 36/126 (28%), Positives = 55/126 (43%), Gaps = 12/126 (9%)
 Frame = +2

Query: 92   LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESG---RSRGFGFVTFADPSLVNLVL 262
            LF+  L+++T++E L+  FS+ G V  C + K         S GFGFV +  P      L
Sbjct: 745  LFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKAL 804

Query: 263  -QNGPHQLDGR----TIDPKPCNPR-TLQKPK---RGGGYPKVFLGGLPSNVTETDLRXI 415
             Q   H +DG      I  +   P  TL + K   R     K+ +  +P      ++R +
Sbjct: 805  KQLQGHVVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIPFQAHSREIREL 864

Query: 416  FRTLWE 433
            F T  E
Sbjct: 865  FSTFGE 870



 Score = 44.4 bits (100), Expect = 3e-04
 Identities = 19/54 (35%), Positives = 35/54 (64%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           E G+LFV  L + +++E+L++ FS+YG + +     +S + + +GF F+TF  P
Sbjct: 413 ESGRLFVRNLPYTSTEEDLEKLFSKYGPLSELHYPIDSLTKKPKGFAFITFMFP 466



 Score = 30.3 bits (65), Expect = 5.3
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKN-SESGRSRGFGFVTF 232
           K+ V  + ++     ++  FS +GE+    + K  + +G  RGFGFV F
Sbjct: 846 KILVRNIPFQAHSREIRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDF 894


>X84841-1|CAA59278.1|  437|Homo sapiens 68 kDa (U1)
           ribonucleoprotein protein.
          Length = 437

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P+   D    LFV  ++++T++  L+R F  YG +    ++ +  SG+ RG+ F+ +  
Sbjct: 94  DPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEH 153

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQ--KPKR-GGGYPKVFLGGLPSNV 391
              ++   ++    ++DGR +       RT++  +P+R GGG      GG   N+
Sbjct: 154 ERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNI 208


>X06812-1|CAA29961.1|  301|Homo sapiens protein ( Human mRNA for
           hU1-70K snRNP protein (RNP8). ).
          Length = 301

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P+   D    LFV  ++++T++  L+R F  YG +    ++ +  SG+ RG+ F+ +  
Sbjct: 45  DPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEH 104

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQ--KPKR-GGGYPKVFLGGLPSNV 391
              ++   ++    ++DGR +       RT++  +P+R GGG      GG   N+
Sbjct: 105 ERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNI 159


>X04654-1|CAA28352.1|  614|Homo sapiens protein ( Human mRNA for U1
           RNA-associated 70K protein. ).
          Length = 614

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P+   D    LFV  ++++T++  L+R F  YG +    ++ +  SG+ RG+ F+ +  
Sbjct: 271 DPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEH 330

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQ--KPKR-GGGYPKVFLGGLPSNV 391
              ++   ++    ++DGR +       RT++  +P+R GGG      GG   N+
Sbjct: 331 ERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNI 385


>M57939-2|AAA36573.1|  428|Homo sapiens ribonucleoprotein antigen
           protein.
          Length = 428

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P+   D    LFV  ++++T++  L+R F  YG +    ++ +  SG+ RG+ F+ +  
Sbjct: 94  DPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEH 153

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQ--KPKR-GGGYPKVFLGGLPSNV 391
              ++   ++    ++DGR +       RT++  +P+R GGG      GG   N+
Sbjct: 154 ERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNI 208


>M57939-1|AAA36572.1|  437|Homo sapiens ribonucleoprotein antigen
           protein.
          Length = 437

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P+   D    LFV  ++++T++  L+R F  YG +    ++ +  SG+ RG+ F+ +  
Sbjct: 94  DPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEH 153

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQ--KPKR-GGGYPKVFLGGLPSNV 391
              ++   ++    ++DGR +       RT++  +P+R GGG      GG   N+
Sbjct: 154 ERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNI 208


>M22636-1|AAA03001.1|  437|Homo sapiens protein ( Human U1 small
           nuclear ribonucleoprotein 70 kd protein mRNA, complete
           cds. ).
          Length = 437

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P+   D    LFV  ++++T++  L+R F  YG +    ++ +  SG+ RG+ F+ +  
Sbjct: 94  DPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEH 153

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQ--KPKR-GGGYPKVFLGGLPSNV 391
              ++   ++    ++DGR +       RT++  +P+R GGG      GG   N+
Sbjct: 154 ERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNI 208


>BC029451-1|AAH29451.1|  425|Homo sapiens RNA binding motif protein
           34 protein.
          Length = 425

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 22/88 (25%), Positives = 48/88 (54%), Gaps = 4/88 (4%)
 Frame = +2

Query: 47  GMRMNPDMDDD----EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG 214
           G R+  D+  +    +K  +FVG L ++  +  ++++F   G ++   ++++  +G  +G
Sbjct: 265 GFRIRVDLASETSSRDKRSVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKG 324

Query: 215 FGFVTFADPSLVNLVLQNGPHQLDGRTI 298
           FG+V F +   V+L L+    +L GR +
Sbjct: 325 FGYVLFENTDSVHLALKLNNSELMGRKL 352


>BC001315-1|AAH01315.1|  437|Homo sapiens small nuclear
           ribonucleoprotein 70kDa polypeptide (RNP antigen)
           protein.
          Length = 437

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 29/115 (25%), Positives = 58/115 (50%), Gaps = 4/115 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P+   D    LFV  ++++T++  L+R F  YG +    ++ +  SG+ RG+ F+ +  
Sbjct: 94  DPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEH 153

Query: 239 PSLVNLVLQNGP-HQLDGRTIDPKPCNPRTLQ--KPKR-GGGYPKVFLGGLPSNV 391
              ++   ++    ++DGR +       RT++  +P+R GGG      GG   N+
Sbjct: 154 ERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNI 208


>AL732292-3|CAM28277.1|  408|Homo sapiens novel protein protein.
          Length = 408

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 22/88 (25%), Positives = 48/88 (54%), Gaps = 4/88 (4%)
 Frame = +2

Query: 47  GMRMNPDMDDD----EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG 214
           G R+  D+  +    +K  +FVG L ++  +  ++++F   G ++   ++++  +G  +G
Sbjct: 248 GFRIRVDLASETSSRDKRSVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKG 307

Query: 215 FGFVTFADPSLVNLVLQNGPHQLDGRTI 298
           FG+V F +   V+L L+    +L GR +
Sbjct: 308 FGYVLFENTDSVHLALKLNNSELMGRKL 335


>AL732292-2|CAI21936.1|  430|Homo sapiens RNA binding motif protein
           34 protein.
          Length = 430

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 22/88 (25%), Positives = 48/88 (54%), Gaps = 4/88 (4%)
 Frame = +2

Query: 47  GMRMNPDMDDD----EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG 214
           G R+  D+  +    +K  +FVG L ++  +  ++++F   G ++   ++++  +G  +G
Sbjct: 270 GFRIRVDLASETSSRDKRSVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKG 329

Query: 215 FGFVTFADPSLVNLVLQNGPHQLDGRTI 298
           FG+V F +   V+L L+    +L GR +
Sbjct: 330 FGYVLFENTDSVHLALKLNNSELMGRKL 357


>AL133418-4|CAM28326.1|  408|Homo sapiens novel protein protein.
          Length = 408

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 22/88 (25%), Positives = 48/88 (54%), Gaps = 4/88 (4%)
 Frame = +2

Query: 47  GMRMNPDMDDD----EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG 214
           G R+  D+  +    +K  +FVG L ++  +  ++++F   G ++   ++++  +G  +G
Sbjct: 248 GFRIRVDLASETSSRDKRSVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKG 307

Query: 215 FGFVTFADPSLVNLVLQNGPHQLDGRTI 298
           FG+V F +   V+L L+    +L GR +
Sbjct: 308 FGYVLFENTDSVHLALKLNNSELMGRKL 335


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 84,962,291
Number of Sequences: 237096
Number of extensions: 1847171
Number of successful extensions: 5895
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 4500
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5702
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6155099854
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -