SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL136089-9|CAI20015.1|  385|Homo sapiens molybdenum cofactor syn...    81   1e-15
AL136089-8|CAI20014.1|  385|Homo sapiens molybdenum cofactor syn...    81   1e-15
AJ293577-1|CAC44527.1|  385|Homo sapiens MOCS1A enzyme protein.        81   1e-15
AJ224328-1|CAA11897.1|  385|Homo sapiens MOCS1A protein protein.       81   1e-15
AF034374-1|AAB87523.1|  385|Homo sapiens molybdenum cofactor bio...    81   1e-15
AL136089-7|CAI20013.1|  448|Homo sapiens molybdenum cofactor syn...    80   3e-15
BC036839-1|AAH36839.1|  281|Homo sapiens MOCS1 protein protein.        32   0.81 
AL136089-6|CAI20012.1|  240|Homo sapiens molybdenum cofactor syn...    32   0.81 
AL136089-5|CAI20011.1|  533|Homo sapiens molybdenum cofactor syn...    32   0.81 
U50315-1|AAC50778.1|  747|Homo sapiens enhancer of zeste homolog...    29   5.7  
BT009782-1|AAP88784.1|  747|Homo sapiens enhancer of zeste homol...    29   5.7  
BC015882-1|AAH15882.1|  747|Homo sapiens enhancer of zeste homol...    29   5.7  
BA000025-34|BAB63394.1|   91|Homo sapiens LST1 protein.                29   5.7  
AF129756-20|AAD18090.1|   91|Homo sapiens LST-1 protein.               29   5.7  
AF000424-1|AAB86998.1|   91|Homo sapiens LST1 protein.                 29   5.7  
AB004818-1|BAA25019.1|  702|Homo sapiens ENX-2 protein.                29   5.7  
AB002386-1|BAA20842.2|  751|Homo sapiens KIAA0388 protein.             29   5.7  
AK090730-1|BAC03509.1|  201|Homo sapiens protein ( Homo sapiens ...    29   7.5  
DQ099382-1|AAZ13758.1|   90|Homo sapiens leukocyte specific tran...    28   9.9  
BC052234-1|AAH52234.1|  417|Homo sapiens wingless-type MMTV inte...    28   9.9  
BC003544-1|AAH03544.1|  293|Homo sapiens Unknown (protein for IM...    28   9.9  
AY009400-1|AAG38660.1|  417|Homo sapiens WNT10a precursor protein.     28   9.9  
AK024363-1|BAB14898.1|  417|Homo sapiens protein ( Homo sapiens ...    28   9.9  
AF315943-2|AAG45153.1|  417|Homo sapiens WNT10A protein.               28   9.9  
AC073128-2|AAY24175.1|  417|Homo sapiens unknown protein.              28   9.9  
AB059569-1|BAB55602.1|  417|Homo sapiens WNT10A protein.               28   9.9  

>AL136089-9|CAI20015.1|  385|Homo sapiens molybdenum cofactor
           synthesis 1 protein.
          Length = 385

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 36/72 (50%), Positives = 45/72 (62%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           +A L+D  GR+H+YLRISLTE+CNLRC+YCMP EGVP               +       
Sbjct: 58  SAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKE 117

Query: 360 GVDKLRXTGGEP 395
           G+DK+R TGGEP
Sbjct: 118 GIDKIRLTGGEP 129


>AL136089-8|CAI20014.1|  385|Homo sapiens molybdenum cofactor
           synthesis 1 protein.
          Length = 385

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 36/72 (50%), Positives = 45/72 (62%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           +A L+D  GR+H+YLRISLTE+CNLRC+YCMP EGVP               +       
Sbjct: 58  SAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKE 117

Query: 360 GVDKLRXTGGEP 395
           G+DK+R TGGEP
Sbjct: 118 GIDKIRLTGGEP 129


>AJ293577-1|CAC44527.1|  385|Homo sapiens MOCS1A enzyme protein.
          Length = 385

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 36/72 (50%), Positives = 45/72 (62%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           +A L+D  GR+H+YLRISLTE+CNLRC+YCMP EGVP               +       
Sbjct: 58  SAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKE 117

Query: 360 GVDKLRXTGGEP 395
           G+DK+R TGGEP
Sbjct: 118 GIDKIRLTGGEP 129


>AJ224328-1|CAA11897.1|  385|Homo sapiens MOCS1A protein protein.
          Length = 385

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 36/72 (50%), Positives = 45/72 (62%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           +A L+D  GR+H+YLRISLTE+CNLRC+YCMP EGVP               +       
Sbjct: 58  SAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKE 117

Query: 360 GVDKLRXTGGEP 395
           G+DK+R TGGEP
Sbjct: 118 GIDKIRLTGGEP 129


>AF034374-1|AAB87523.1|  385|Homo sapiens molybdenum cofactor
           biosynthesis protein A protein.
          Length = 385

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 36/72 (50%), Positives = 45/72 (62%)
 Frame = +3

Query: 180 AASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAA 359
           +A L+D  GR+H+YLRISLTE+CNLRC+YCMP EGVP               +       
Sbjct: 58  SAFLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKANLLTTEEILTLARLFVKE 117

Query: 360 GVDKLRXTGGEP 395
           G+DK+R TGGEP
Sbjct: 118 GIDKIRLTGGEP 129


>AL136089-7|CAI20013.1|  448|Homo sapiens molybdenum cofactor
           synthesis 1 protein.
          Length = 448

 Score = 79.8 bits (188), Expect = 3e-15
 Identities = 35/69 (50%), Positives = 43/69 (62%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D  GR+H+YLRISLTE+CNLRC+YCMP EGVP               +       G+D
Sbjct: 1   LTDSFGRQHSYLRISLTEKCNLRCEYCMPEEGVPLTPKANLLTTEEILTLARLFVKEGID 60

Query: 369 KLRXTGGEP 395
           K+R TGGEP
Sbjct: 61  KIRLTGGEP 69


>BC036839-1|AAH36839.1|  281|Homo sapiens MOCS1 protein protein.
          Length = 281

 Score = 31.9 bits (69), Expect = 0.81
 Identities = 15/42 (35%), Positives = 18/42 (42%)
 Frame = +3

Query: 270 MPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395
           MP EGVP               +       G+DK+R TGGEP
Sbjct: 1   MPEEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEP 42


>AL136089-6|CAI20012.1|  240|Homo sapiens molybdenum cofactor
           synthesis 1 protein.
          Length = 240

 Score = 31.9 bits (69), Expect = 0.81
 Identities = 15/42 (35%), Positives = 18/42 (42%)
 Frame = +3

Query: 270 MPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395
           MP EGVP               +       G+DK+R TGGEP
Sbjct: 1   MPEEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEP 42


>AL136089-5|CAI20011.1|  533|Homo sapiens molybdenum cofactor
           synthesis 1 protein.
          Length = 533

 Score = 31.9 bits (69), Expect = 0.81
 Identities = 15/42 (35%), Positives = 18/42 (42%)
 Frame = +3

Query: 270 MPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVDKLRXTGGEP 395
           MP EGVP               +       G+DK+R TGGEP
Sbjct: 1   MPEEGVPLTPKANLLTTEEILTLARLFVKEGIDKIRLTGGEP 42


>U50315-1|AAC50778.1|  747|Homo sapiens enhancer of zeste homolog 1
           protein.
          Length = 747

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 11/26 (42%), Positives = 12/26 (46%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSC 330
           C   T C  K CPC +A R C    C
Sbjct: 561 CRCKTQCNTKQCPCYLAVRECDPDLC 586


>BT009782-1|AAP88784.1|  747|Homo sapiens enhancer of zeste homolog
           1 (Drosophila) protein.
          Length = 747

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 11/26 (42%), Positives = 12/26 (46%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSC 330
           C   T C  K CPC +A R C    C
Sbjct: 561 CRCKTQCNTKQCPCYLAVRECDPDLC 586


>BC015882-1|AAH15882.1|  747|Homo sapiens enhancer of zeste homolog
           1 (Drosophila) protein.
          Length = 747

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 11/26 (42%), Positives = 12/26 (46%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSC 330
           C   T C  K CPC +A R C    C
Sbjct: 561 CRCKTQCNTKQCPCYLAVRECDPDLC 586


>BA000025-34|BAB63394.1|   91|Homo sapiens LST1 protein.
          Length = 91

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 1/48 (2%)
 Frame = -1

Query: 312 AASCDWTGARLPPACSTCIAGCIAQ*EIFAGSCVDD-HVGRLMRPPPP 172
           A SC W  +  PPAC  CI   +       GS   + H   L R P P
Sbjct: 12  AGSCFWQWSFCPPACVGCIEEHLLSWSQAQGSSEQELHYASLQRLPVP 59


>AF129756-20|AAD18090.1|   91|Homo sapiens LST-1 protein.
          Length = 91

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 1/48 (2%)
 Frame = -1

Query: 312 AASCDWTGARLPPACSTCIAGCIAQ*EIFAGSCVDD-HVGRLMRPPPP 172
           A SC W  +  PPAC  CI   +       GS   + H   L R P P
Sbjct: 12  AGSCFWQWSFCPPACVGCIEEHLLSWSQAQGSSEQELHYASLQRLPVP 59


>AF000424-1|AAB86998.1|   91|Homo sapiens LST1 protein.
          Length = 91

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 1/48 (2%)
 Frame = -1

Query: 312 AASCDWTGARLPPACSTCIAGCIAQ*EIFAGSCVDD-HVGRLMRPPPP 172
           A SC W  +  PPAC  CI   +       GS   + H   L R P P
Sbjct: 12  AGSCFWQWSFCPPACVGCIEEHLLSWSQAQGSSEQELHYASLQRLPVP 59


>AB004818-1|BAA25019.1|  702|Homo sapiens ENX-2 protein.
          Length = 702

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 11/26 (42%), Positives = 12/26 (46%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSC 330
           C   T C  K CPC +A R C    C
Sbjct: 560 CRCKTQCNTKQCPCYLAVRECDPDLC 585


>AB002386-1|BAA20842.2|  751|Homo sapiens KIAA0388 protein.
          Length = 751

 Score = 29.1 bits (62), Expect = 5.7
 Identities = 11/26 (42%), Positives = 12/26 (46%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSC 330
           C   T C  K CPC +A R C    C
Sbjct: 565 CRCKTQCNTKQCPCYLAVRECDPDLC 590


>AK090730-1|BAC03509.1|  201|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33411 fis, clone BRACE2019467, moderately
           similar to UDP-GALACTOSE TRANSLOCATOR. ).
          Length = 201

 Score = 28.7 bits (61), Expect = 7.5
 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 9/56 (16%)
 Frame = +1

Query: 226 EYLSLSD---ATCDASTACRR-KACPCPVAARCCQWKSCG*XWARW-----RPPAW 366
           +Y+++S+   AT   ST  R  KA   P     C W S    WA W     R P W
Sbjct: 57  QYVAISNLPAATFQVSTLRRSSKAAQAPCGCATCNWASSAQHWAWWGSGGLRVPPW 112


>DQ099382-1|AAZ13758.1|   90|Homo sapiens leukocyte specific
           transcript 1 protein.
          Length = 90

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 16/47 (34%), Positives = 20/47 (42%)
 Frame = -1

Query: 312 AASCDWTGARLPPACSTCIAGCIAQ*EIFAGSCVDDHVGRLMRPPPP 172
           A SC W  +  PPAC  CI   + +      S  + H   L R P P
Sbjct: 12  AGSCFWQWSFCPPACVGCIEERLERSWAQGSSEQELHYASLQRLPVP 58


>BC052234-1|AAH52234.1|  417|Homo sapiens wingless-type MMTV
           integration site family, member 10A protein.
          Length = 417

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +3

Query: 204 GRRHNYLRISLTERCNLRCKYC 269
           GR HN LR + +ERC+ R  +C
Sbjct: 378 GRGHNILRQTRSERCHCRFHWC 399


>BC003544-1|AAH03544.1|  293|Homo sapiens Unknown (protein for
           IMAGE:3611751) protein.
          Length = 293

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +3

Query: 204 GRRHNYLRISLTERCNLRCKYC 269
           GR HN LR + +ERC+ R  +C
Sbjct: 254 GRGHNILRQTRSERCHCRFHWC 275


>AY009400-1|AAG38660.1|  417|Homo sapiens WNT10a precursor protein.
          Length = 417

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +3

Query: 204 GRRHNYLRISLTERCNLRCKYC 269
           GR HN LR + +ERC+ R  +C
Sbjct: 378 GRGHNILRQTRSERCHCRFHWC 399


>AK024363-1|BAB14898.1|  417|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14301 fis, clone PLACE1011896, highly similar to
           Mus musculus Wnt10a mRNA. ).
          Length = 417

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +3

Query: 204 GRRHNYLRISLTERCNLRCKYC 269
           GR HN LR + +ERC+ R  +C
Sbjct: 378 GRGHNILRQTRSERCHCRFHWC 399


>AF315943-2|AAG45153.1|  417|Homo sapiens WNT10A protein.
          Length = 417

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +3

Query: 204 GRRHNYLRISLTERCNLRCKYC 269
           GR HN LR + +ERC+ R  +C
Sbjct: 378 GRGHNILRQTRSERCHCRFHWC 399


>AC073128-2|AAY24175.1|  417|Homo sapiens unknown protein.
          Length = 417

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +3

Query: 204 GRRHNYLRISLTERCNLRCKYC 269
           GR HN LR + +ERC+ R  +C
Sbjct: 378 GRGHNILRQTRSERCHCRFHWC 399


>AB059569-1|BAB55602.1|  417|Homo sapiens WNT10A protein.
          Length = 417

 Score = 28.3 bits (60), Expect = 9.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +3

Query: 204 GRRHNYLRISLTERCNLRCKYC 269
           GR HN LR + +ERC+ R  +C
Sbjct: 378 GRGHNILRQTRSERCHCRFHWC 399


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 57,089,053
Number of Sequences: 237096
Number of extensions: 1184858
Number of successful extensions: 2846
Number of sequences better than 10.0: 26
Number of HSP's better than 10.0 without gapping: 2517
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2819
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2870859500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -