SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC034988-1|AAH34988.1| 1036|Homo sapiens ULK2 protein protein.         50   1e-05
AB014523-1|BAA31598.2| 1100|Homo sapiens KIAA0623 protein protein.     50   1e-05
U66064-1|AAB80848.1|  315|Homo sapiens calcium/calmodulin-depend...    47   9e-05
BC034044-1|AAH34044.1|  527|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AL713896-5|CAI13790.1|  529|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AL713896-4|CAI13789.1|  495|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AL713896-3|CAI13791.1|  527|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AL713896-2|CAI13788.1|  516|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AL596247-5|CAI13965.1|  529|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AL596247-4|CAI13966.1|  495|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AL596247-3|CAI13968.1|  527|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AL596247-2|CAI13967.1|  516|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AF415197-1|AAM33514.1|  566|Homo sapiens calcium/calmodulin-depe...    47   9e-05
AF054621-1|AAC25955.1|  309|Homo sapiens serine/threonine kinase...    47   9e-05
BC009107-1|AAH09107.1|  879|Homo sapiens microtubule associated ...    46   1e-04
AL160291-7|CAI16908.1|  878|Homo sapiens novel protein kinase do...    46   1e-04
AL160291-6|CAI16909.1|  879|Homo sapiens novel protein kinase do...    46   1e-04
AL160291-5|CAI16910.1|  840|Homo sapiens novel protein kinase do...    46   1e-04
AK074804-1|BAC11218.1|  840|Homo sapiens protein ( Homo sapiens ...    46   1e-04
AK027719-1|BAB55321.1|  878|Homo sapiens protein ( Homo sapiens ...    46   1e-04
X90568-1|CAA62188.1|26926|Homo sapiens titin protein.                  46   2e-04
X69490-1|CAA49245.1| 4650|Homo sapiens titin protein.                  46   2e-04
X64697-1|CAA45938.1| 3100|Homo sapiens titin protein.                  46   2e-04
L07043-1|AAB61379.1|  306|Homo sapiens calcium/calmodulin-depend...    46   2e-04
BC021269-1|AAH21269.2|  453|Homo sapiens CAMK2G protein protein.       46   2e-04
AL713896-1|CAI13787.1|  453|Homo sapiens calcium/calmodulin-depe...    46   2e-04
AL596247-1|CAI13964.1|  453|Homo sapiens calcium/calmodulin-depe...    46   2e-04
AJ277892-1|CAD12455.1|26926|Homo sapiens N2B-Titin Isoform protein.    46   2e-04
AF090421-1|AAC69577.1|  809|Homo sapiens ribosome S6 protein kin...    46   2e-04
BC075064-1|AAH75064.2|  275|Homo sapiens AURKC protein protein.        46   2e-04
AY714054-1|AAU04399.1|  306|Homo sapiens aurora-C protein.             46   2e-04
AY661554-1|AAT64422.1|  290|Homo sapiens aurora/Ipl1-related kin...    46   2e-04
AK027302-1|BAB55026.1|  208|Homo sapiens protein ( Homo sapiens ...    46   2e-04
AB017332-1|BAA76292.1|  309|Homo sapiens Aurora/Ipl1-related kin...    46   2e-04
AB011109-1|BAA25463.2|  698|Homo sapiens KIAA0537 protein protein.     46   2e-04
BC026158-1|AAH26158.1| 1315|Homo sapiens serine/threonine kinase...    45   3e-04
AF200815-1|AAF97028.1| 1315|Homo sapiens FUSED serine/threonine ...    45   3e-04
AB033104-1|BAA86592.1| 1311|Homo sapiens KIAA1278 protein protein.     45   3e-04
Z29067-1|CAA82310.1|  459|Homo sapiens protein kinase protein.         45   4e-04
X80590-1|CAA56681.1|  387|Homo sapiens phosphorylase kinase prot...    45   4e-04
BC109097-1|AAI09098.2|  795|Homo sapiens MLCK protein protein.         45   4e-04
BC074753-1|AAH74753.1|  387|Homo sapiens phosphorylase kinase, g...    45   4e-04
BC069754-1|AAH69754.1|  387|Homo sapiens phosphorylase kinase, g...    45   4e-04
BC069738-1|AAH69738.1|  387|Homo sapiens phosphorylase kinase, g...    45   4e-04
BC069679-1|AAH69679.1|  387|Homo sapiens phosphorylase kinase, g...    45   4e-04
BC051327-1|AAH51327.1|  387|Homo sapiens phosphorylase kinase, g...    45   4e-04
BC036422-1|AAH36422.1|  436|Homo sapiens hypothetical protein MG...    45   4e-04
BC019916-1|AAH19916.2|  506|Homo sapiens NIMA (never in mitosis ...    45   4e-04
BC017306-1|AAH17306.1|  628|Homo sapiens NUAK family, SNF1-like ...    45   4e-04
BC017187-1|AAH17187.1|  549|Homo sapiens ribosomal protein S6 ki...    45   4e-04
AL139082-7|CAI12895.1|  507|Homo sapiens NIMA (never in mitosis ...    45   4e-04
AK131359-1|BAD18511.1|  510|Homo sapiens protein ( Homo sapiens ...    45   4e-04
AK074830-1|BAC11234.1|  628|Homo sapiens protein ( Homo sapiens ...    45   4e-04
AJ247087-1|CAC42766.1|  795|Homo sapiens myosin light chain kina...    45   4e-04
AF254253-1|AAL36972.1|  387|Homo sapiens phosphorylase kinase ga...    45   4e-04
AF080000-1|AAD23915.1|  802|Homo sapiens RSK-like protein kinase...    45   4e-04
AF074393-1|AAC31171.1|  802|Homo sapiens nuclear mitogen- and st...    45   4e-04
AC092101-3|AAS07453.1|  387|Homo sapiens unknown protein.              45   4e-04
AB072828-1|BAC15599.1|  489|Homo sapiens NIMA-related protein ki...    45   4e-04
AF059681-1|AAC77369.1|  275|Homo sapiens serine/threonine kinase...    44   5e-04
AY505125-1|AAS86443.1|  696|Homo sapiens protein kinase SAD-A pr...    44   7e-04
AY166857-1|AAN87839.1|  668|Homo sapiens serine/threonine protei...    44   7e-04
AK131534-1|BAD18671.1|  766|Homo sapiens protein ( Homo sapiens ...    44   7e-04
AF533880-1|AAP97727.1|  674|Homo sapiens putative serine/threoni...    44   7e-04
AF533879-1|AAP97726.1|  736|Homo sapiens putative serine/threoni...    44   7e-04
AF533878-1|AAP97725.1|  674|Homo sapiens putative serine/threoni...    44   7e-04
AF533877-1|AAP97724.1|  674|Homo sapiens putative serine/threoni...    44   7e-04
AF533876-1|AAP97723.1|  668|Homo sapiens putative serine/threoni...    44   7e-04
Y11950-1|CAA72694.1|  406|Homo sapiens phosphorylase kinase gamm...    44   9e-04
M31606-1|AAA36442.1|  406|Homo sapiens phosphorylase kinase prot...    44   9e-04
BC132833-1|AAI32834.1|  388|Homo sapiens hypothetical protein LO...    44   9e-04
BC132831-1|AAI32832.1|  388|Homo sapiens hypothetical protein LO...    44   9e-04
BC002541-1|AAH02541.1|  406|Homo sapiens phosphorylase kinase, g...    44   9e-04
AL139092-1|CAH73662.1|  388|Homo sapiens protein ( Human DNA seq...    44   9e-04
AL138876-2|CAI12221.2|  388|Homo sapiens protein ( Human DNA seq...    44   9e-04
AK131198-1|BAD18393.1|  706|Homo sapiens protein ( Homo sapiens ...    43   0.001
AY120867-1|AAM55491.1|  752|Homo sapiens MAP/microtubule affinit...    43   0.002
AY057448-1|AAL23683.1|  752|Homo sapiens MARK4 serine/threonine ...    43   0.002
AK075272-1|BAC11510.1|  752|Homo sapiens protein ( Homo sapiens ...    43   0.002
AJ006701-1|CAA07196.1|  603|Homo sapiens putative serine/threoni...    43   0.002
AF045458-1|AAC32326.1| 1050|Homo sapiens serine/threonine kinase...    43   0.002
AB088047-1|BAC03375.1|  752|Homo sapiens microtubule affinity-re...    43   0.002
AB058763-1|BAB47489.1|  689|Homo sapiens KIAA1860 protein protein.     43   0.002
AB049127-1|BAB39380.1|  688|Homo sapiens MAP/microtubule affinit...    43   0.002
AB018265-1|BAA34442.2| 1066|Homo sapiens KIAA0722 protein protein.     43   0.002
U64205-1|AAC15093.1|  729|Homo sapiens Cdc25C associated protein...    42   0.002
BC024773-1|AAH24773.1|  729|Homo sapiens MAP/microtubule affinit...    42   0.002
AF387637-1|AAK82367.1|  744|Homo sapiens Ser/Thr protein kinase ...    42   0.002
U22456-1|AAA64850.1|  174|Homo sapiens AMP-activated protein kin...    42   0.003
U06454-1|AAA64745.1|  552|Homo sapiens AMP-activated protein kin...    42   0.003
EF056019-1|ABK30810.1|  552|Homo sapiens AMP-activated alpha 2 s...    42   0.003
BC069823-1|AAH69823.1|  552|Homo sapiens AMP-activated protein k...    42   0.003
BC069740-1|AAH69740.1|  552|Homo sapiens AMP-activated protein k...    42   0.003
BC069680-1|AAH69680.1|  552|Homo sapiens protein kinase, AMP-act...    42   0.003
BC037303-1|AAH37303.1|  550|Homo sapiens PRKAA1 protein protein.       42   0.003
BC012622-1|AAH12622.1|  207|Homo sapiens PRKAA1 protein protein.       42   0.003
AL035705-2|CAC17574.2|  552|Homo sapiens protein kinase, AMP-act...    42   0.003
AB022017-1|BAA36547.1|  550|Homo sapiens AMP-activated protein k...    42   0.003
BC032784-1|AAH32784.1|  478|Homo sapiens calcium/calmodulin-depe...    42   0.003
AY987011-1|AAX88806.1|  489|Homo sapiens calcium/calmodulin-depe...    42   0.003
AY505124-1|AAS86442.1|  778|Homo sapiens protein kinase SAD-B pr...    42   0.003
AY458602-1|AAS10354.1|  778|Homo sapiens SAD1 kinase protein.          42   0.003
AJ252239-1|CAB65123.1|  243|Homo sapiens calcium/calmodulin depe...    42   0.003
AF479827-1|AAL87698.1|  778|Homo sapiens protein kinase-like pro...    42   0.003
AF479826-1|AAL87697.1|  794|Homo sapiens putative serine/threoni...    42   0.003
AF164041-1|AAD50272.1| 1130|Homo sapiens WARTS protein kinase pr...    42   0.003
AF104413-1|AAD16882.1| 1130|Homo sapiens large tumor suppressor ...    42   0.003
AF071569-1|AAD20442.1|  499|Homo sapiens multifunctional calcium...    42   0.003
AB209426-1|BAD92663.1|  830|Homo sapiens LATS homolog 1 variant ...    42   0.003
AB209288-1|BAD92525.1|  522|Homo sapiens calcium/calmodulin-depe...    42   0.003
AB058714-1|BAB47440.1|  715|Homo sapiens KIAA1811 protein protein.     42   0.003
M80359-1|AAA59991.1|  713|Homo sapiens protein p78 protein.            41   0.005
BT019534-1|AAV38341.1|  344|Homo sapiens serine/threonine kinase...    41   0.005
BC080581-1|AAH80581.1|  344|Homo sapiens aurora kinase B protein.      41   0.005
BC038504-1|AAH38504.1|  783|Homo sapiens SNF1-like kinase protein.     41   0.005
BC013300-1|AAH13300.2|  371|Homo sapiens AURKB protein protein.        41   0.005
BC009751-1|AAH09751.1|  344|Homo sapiens aurora kinase B protein.      41   0.005
BC000442-1|AAH00442.3|  344|Homo sapiens aurora kinase B protein.      41   0.005
AP001751-1|BAA95536.1|  786|Homo sapiens SNF1LK protein.               41   0.005
AK131076-1|BAC85126.1|  764|Homo sapiens FLJ00263 protein protein.     41   0.005
AF465413-1|AAL69982.1|  753|Homo sapiens MAP/microtubule affinit...    41   0.005
AF008552-1|AAC12709.1|  344|Homo sapiens aurora-related kinase 2...    41   0.005
AB047786-1|BAD74070.1|  783|Homo sapiens serine/threonine protei...    41   0.005
AB011450-1|BAA32136.1|  344|Homo sapiens aurora and IPL1-like mi...    41   0.005
AB011446-1|BAA82709.1|  343|Homo sapiens Aik2 protein.                 41   0.005
L24959-1|AAA18251.1|  473|Homo sapiens calcium/calmodulin depend...    41   0.006
L17000-1|AAA35639.1|  473|Homo sapiens calcium/calmodulin-depend...    41   0.006
D30742-1|BAA06403.1|  473|Homo sapiens calmodulin-dependent prot...    41   0.006
BC114478-1|AAI14479.1|  795|Homo sapiens MARK1 protein protein.        41   0.006
BC113869-1|AAI13870.1|  795|Homo sapiens MARK1 protein protein.        41   0.006
BC025687-1|AAH25687.1|  473|Homo sapiens calcium/calmodulin-depe...    41   0.006
BC016695-1|AAH16695.2|  503|Homo sapiens CAMK4 protein protein.        41   0.006
AL592406-3|CAH72463.1|  795|Homo sapiens MAP/microtubule affinit...    41   0.006
AF154845-1|AAF72103.1|  795|Homo sapiens MARK protein.                 41   0.006
AB051552-1|BAB21856.1|  608|Homo sapiens KIAA1765 protein protein.     41   0.006
X66358-1|CAA47002.1|  358|Homo sapiens serine/threonine protein ...    40   0.008
D86968-1|BAA13204.2| 1626|Homo sapiens KIAA0213 protein.               40   0.008
BC146770-1|AAI46771.1| 1558|Homo sapiens mitogen-activated prote...    40   0.008
BC104977-1|AAI04978.1|  358|Homo sapiens cyclin-dependent kinase...    40   0.008
BC069655-1|AAH69655.1|  390|Homo sapiens PHKG1 protein protein.        40   0.008
AY525548-1|AAS00095.1|  358|Homo sapiens cyclin-dependent kinase...    40   0.008
AL596452-3|CAI41309.1| 1498|Homo sapiens mitogen-activated prote...    40   0.008
AL596452-2|CAI41310.1| 1544|Homo sapiens mitogen-activated prote...    40   0.008
AL591045-2|CAH70639.1| 1498|Homo sapiens mitogen-activated prote...    40   0.008
AL591045-1|CAH70640.1| 1544|Homo sapiens mitogen-activated prote...    40   0.008
AL139393-2|CAI20815.1| 1498|Homo sapiens mitogen-activated prote...    40   0.008
AL139393-1|CAI20816.1| 1544|Homo sapiens mitogen-activated prote...    40   0.008
AL109942-4|CAI21477.1| 1498|Homo sapiens mitogen-activated prote...    40   0.008
AL109942-3|CAC12766.2| 1544|Homo sapiens mitogen-activated prote...    40   0.008
AF002715-1|AAB68804.1| 1607|Homo sapiens MAP kinase kinase kinas...    40   0.008
X97630-1|CAA66229.1|  745|Homo sapiens serine/threonine protein ...    40   0.011
D84212-1|BAA23592.1|  402|Homo sapiens aurora/IPL1-related kinas...    40   0.011
BT007342-1|AAP36006.1|  755|Homo sapiens MAP/microtubule affinit...    40   0.011
BC084540-1|AAH84540.1|  724|Homo sapiens MAP/microtubule affinit...    40   0.011
BC040457-1|AAH40457.1|  478|Homo sapiens calcium/calmodulin-depe...    40   0.011
BC035745-1|AAH35745.1|  385|Homo sapiens calcium/calmodulin-depe...    40   0.011
BC008771-1|AAH08771.2|  778|Homo sapiens MARK2 protein protein.        40   0.011
AL731559-2|CAI14675.1|  385|Homo sapiens calcium/calmodulin-depe...    40   0.011
AL731559-1|CAI14674.1|  357|Homo sapiens calcium/calmodulin-depe...    40   0.011
AL512783-2|CAH74036.1|  385|Homo sapiens calcium/calmodulin-depe...    40   0.011
AL512783-1|CAH74035.1|  357|Homo sapiens calcium/calmodulin-depe...    40   0.011
AL512284-2|CAH71694.1|  385|Homo sapiens calcium/calmodulin-depe...    40   0.011
AL512284-1|CAH71693.1|  357|Homo sapiens calcium/calmodulin-depe...    40   0.011
AL391314-2|CAI14410.1|  385|Homo sapiens calcium/calmodulin-depe...    40   0.011
AL391314-1|CAI14409.1|  357|Homo sapiens calcium/calmodulin-depe...    40   0.011
AF387638-1|AAK82368.1|  691|Homo sapiens Ser/Thr protein kinase ...    40   0.011
AF286366-1|AAG00534.1|  357|Homo sapiens CamKI-like protein kina...    40   0.011
AF145711-1|AAD30559.1|  489|Homo sapiens calcium/calmodulin-depe...    40   0.011
AF145710-1|AAD30558.1|  478|Homo sapiens calcium/calmodulin-depe...    40   0.011
AF091486-1|AAD55815.1|  478|Homo sapiens calmodulin-dependent pr...    40   0.011
AB188493-1|BAD37141.1|  719|Homo sapiens serine/threonine kinase...    40   0.011
AB081726-1|BAC19846.1|  385|Homo sapiens CaM-kinase I delta prot...    40   0.011
AB023185-1|BAA76812.1|  527|Homo sapiens KIAA0968 protein protein.     40   0.011
U66464-1|AAB97983.1|  833|Homo sapiens hematopoietic progenitor ...    40   0.014
BC127622-1|AAI27623.1|  596|Homo sapiens myosin light chain kina...    40   0.014
BC092413-1|AAH92413.1|  596|Homo sapiens myosin light chain kina...    40   0.014
BC069627-1|AAH69627.1|  596|Homo sapiens skeletal myosin light c...    40   0.014
AL160175-10|CAC10006.1|  596|Homo sapiens myosin light chain kin...    40   0.014
AJ272502-1|CAC81354.1|  596|Homo sapiens skeletal muscle-specifi...    40   0.014
AF325549-1|AAK15494.1|  596|Homo sapiens skeletal myosin light c...    40   0.014
AB062450-1|BAB85632.1|  302|Homo sapiens NEK7 protein.                 40   0.014
X75346-1|CAA53094.1|  396|Homo sapiens MAP kinase activated prot...    39   0.019
U12779-1|AAA20851.1|  370|Homo sapiens MAP kinase activated prot...    39   0.019
D86959-1|BAA13195.2| 1164|Homo sapiens KIAA0204 protein protein.       39   0.019
BC111565-1|AAI11566.1| 1204|Homo sapiens SLK protein protein.          39   0.019
BC064804-1|AAH64804.1|  617|Homo sapiens SLK protein protein.          39   0.019
BC052584-1|AAH52584.1|  400|Homo sapiens mitogen-activated prote...    39   0.019
BC047885-1|AAH47885.1|  426|Homo sapiens SLK protein protein.          39   0.019
BC047762-1|AAH47762.1|  614|Homo sapiens SLK protein protein.          39   0.019
BC036060-1|AAH36060.2|  400|Homo sapiens mitogen-activated prote...    39   0.019
BC027464-1|AAH27464.1|  403|Homo sapiens aurora kinase A protein.      39   0.019
BC006423-1|AAH06423.1|  403|Homo sapiens aurora kinase A protein.      39   0.019
BC002499-1|AAH02499.1|  403|Homo sapiens AURKA protein protein.        39   0.019
BC001280-1|AAH01280.1|  403|Homo sapiens aurora kinase A protein.      39   0.019
AL591846-12|CAI13544.1|  400|Homo sapiens mitogen-activated prot...    39   0.019
AL591846-11|CAI13543.1|  370|Homo sapiens mitogen-activated prot...    39   0.019
AL360170-2|CAH70404.1| 1235|Homo sapiens Ste20-related serine\/t...    39   0.019
AL360170-1|CAH70403.1| 1204|Homo sapiens Ste20-related serine\/t...    39   0.019
AL138761-2|CAI12395.1| 1235|Homo sapiens Ste20-related serine\/t...    39   0.019
AL138761-1|CAI12396.1| 1204|Homo sapiens Ste20-related serine\/t...    39   0.019
AL121914-5|CAI19324.1|  271|Homo sapiens aurora kinase A protein.      39   0.019
AL121914-4|CAM45838.1|  347|Homo sapiens aurora kinase A protein.      39   0.019
AL121914-3|CAC12717.1|  403|Homo sapiens aurora kinase A protein.      39   0.019
AF273048-1|AAG34908.1| 1235|Homo sapiens CTCL tumor antigen se20...    39   0.019
AF195947-1|AAF29508.1|  403|Homo sapiens STK15 serine/threonine ...    39   0.019
AF011468-1|AAC63902.1|  403|Homo sapiens serine/threonine kinase...    39   0.019
AF008551-1|AAC12708.1|  403|Homo sapiens aurora-related kinase 1...    39   0.019
AB011422-1|BAA76314.1| 1289|Homo sapiens Trad protein.                 39   0.019
AB002804-1|BAA19655.1| 1204|Homo sapiens hSLK protein.                 39   0.019
BC114491-1|AAI14492.1| 1189|Homo sapiens NEK1 protein protein.         39   0.025
BC022558-1|AAH22558.1|  344|Homo sapiens CAMK2D protein protein.       39   0.025
BC015147-1|AAH15147.1|  403|Homo sapiens Unknown (protein for IM...    39   0.025
AL390029-2|CAI15721.1|  740|Homo sapiens doublecortin and CaM ki...    39   0.025
AL390029-1|CAI15720.1|  729|Homo sapiens doublecortin and CaM ki...    39   0.025
AL356285-1|CAI15861.1| 1088|Homo sapiens LATS, large tumor suppr...    39   0.025
AL161613-1|CAH71526.1| 1088|Homo sapiens LATS, large tumor suppr...    39   0.025
AL160392-2|CAH70261.1|  740|Homo sapiens doublecortin and CaM ki...    39   0.025
AL160392-1|CAH70262.1|  729|Homo sapiens doublecortin and CaM ki...    39   0.025
AL157760-4|CAH70170.1|  433|Homo sapiens doublecortin and CaM ki...    39   0.025
AL157760-2|CAH70167.1|  740|Homo sapiens doublecortin and CaM ki...    39   0.025
AL157760-1|CAH70168.1|  729|Homo sapiens doublecortin and CaM ki...    39   0.025
AL157694-2|CAH70656.1|  740|Homo sapiens doublecortin and CaM ki...    39   0.025
AL157694-1|CAH70657.1|  729|Homo sapiens doublecortin and CaM ki...    39   0.025
AF207547-1|AAF80561.1| 1088|Homo sapiens serine/threonine kinase...    39   0.025
AB209897-1|BAD93134.1|  924|Homo sapiens LATS, large tumor suppr...    39   0.025
AB067488-1|BAB67794.1| 1265|Homo sapiens KIAA1901 protein protein.     39   0.025
AB028019-1|BAA92381.1| 1046|Homo sapiens large tumor suppressor ...    39   0.025
AB002367-1|BAA20824.2|  794|Homo sapiens KIAA0369 protein.             39   0.025
Z25434-1|CAA80921.1|  114|Homo sapiens protein-serine/threonine ...    38   0.032
BC113705-1|AAI13706.1|  692|Homo sapiens NIMA (never in mitosis ...    38   0.032
BC112240-1|AAI12241.1|  692|Homo sapiens NIMA-related kinase 8 p...    38   0.032
AY267371-1|AAP04006.1|  692|Homo sapiens NIMA-family kinase NEK8...    38   0.032
AY242354-1|AAO88243.1|  692|Homo sapiens NIMA-related kinase 12a...    38   0.032
U85755-1|AAD00575.1|  299|Homo sapiens serum-inducible kinase pr...    38   0.043
CR542222-1|CAG47018.1|  306|Homo sapiens NEK6 protein.                 38   0.043
CR457091-1|CAG33372.1|  306|Homo sapiens NEK6 protein.                 38   0.043
BC114506-1|AAI14507.1|  370|Homo sapiens death-associated protei...    38   0.043
BC053536-1|AAH53536.1|  231|Homo sapiens RAGE protein protein.         38   0.043
BC047696-1|AAH47696.1|  414|Homo sapiens serine/threonine kinase...    38   0.043
BC039825-1|AAH39825.1|  457|Homo sapiens MAK protein protein.          38   0.043
BC023508-1|AAH23508.2|  414|Homo sapiens serine/threonine kinase...    38   0.043
BC013879-1|AAH13879.1|  685|Homo sapiens polo-like kinase 2 (Dro...    38   0.043
BC012761-1|AAH12761.1|  313|Homo sapiens NIMA (never in mitosis ...    38   0.043
BC004209-1|AAH04209.2|  313|Homo sapiens NEK6 protein protein.         38   0.043
BC004174-1|AAH04174.2|  313|Homo sapiens NEK6 protein protein.         38   0.043
BC000101-1|AAH00101.2|  313|Homo sapiens NEK6 protein protein.         38   0.043
AL162724-9|CAH70254.1|  313|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL162724-7|CAH70252.1|  222|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL162724-6|CAH70251.1|  220|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL162724-5|CAH70250.1|  219|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL162724-4|CAH70249.1|  207|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL162724-2|CAH70247.1|  347|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL137846-13|CAI10883.1|  313|Homo sapiens NIMA (never in mitosis...    38   0.043
AL137846-11|CAI10881.1|  222|Homo sapiens NIMA (never in mitosis...    38   0.043
AL137846-10|CAI10880.1|  220|Homo sapiens NIMA (never in mitosis...    38   0.043
AL137846-9|CAI10879.1|  219|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL137846-8|CAI10878.1|  207|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL137846-6|CAI10876.1|  347|Homo sapiens NIMA (never in mitosis ...    38   0.043
AL024498-4|CAB75823.1|  623|Homo sapiens protein ( ovel serine/t...    38   0.043
AK098163-1|BAC05247.1|  372|Homo sapiens protein ( Homo sapiens ...    38   0.043
AF505623-1|AAN16405.1|  623|Homo sapiens male germ cell-associat...    38   0.043
AF223574-1|AAF62897.1|  685|Homo sapiens serum-inducible kinase ...    38   0.043
AF087909-1|AAG13417.1|  338|Homo sapiens NIMA-related kinase 6 p...    38   0.043
AF059617-1|AAC14573.1|  685|Homo sapiens serum-inducible kinase ...    38   0.043
AF052941-1|AAC35001.1|  370|Homo sapiens DAP-kinase related prot...    38   0.043
AC093645-1|AAP22356.1|  161|Homo sapiens unknown protein.              38   0.043
AB026289-1|BAA85045.1|  306|Homo sapiens protein kinase SID6-151...    38   0.043
AB022694-1|BAA81688.1|  419|Homo sapiens MOK protein kinase prot...    38   0.043
AB018001-1|BAA88063.1|  370|Homo sapiens Death-associated protei...    38   0.043
AB011420-1|BAA34126.1|  414|Homo sapiens DRAK1 protein.                38   0.043
BC063585-1|AAH63585.1| 1323|Homo sapiens PAS domain containing s...    38   0.057
BC043495-1|AAH43495.1|  953|Homo sapiens PASK protein protein.         38   0.057
AL670729-4|CAH71670.2| 2582|Homo sapiens obscurin, cytoskeletal ...    38   0.057
AL353593-4|CAM27610.1| 2582|Homo sapiens obscurin, cytoskeletal ...    38   0.057
AF387103-1|AAK69752.1| 1323|Homo sapiens PAS-kinase protein.           38   0.057
AB046859-1|BAB13465.2| 2584|Homo sapiens KIAA1639 protein protein.     38   0.057
BC117311-1|AAI17312.1|  898|Homo sapiens CASK protein protein.         37   0.075
BC035807-1|AAH35807.1|  292|Homo sapiens ICK protein protein.          37   0.075
AY705392-1|AAU10527.1|  921|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL627402-6|CAH71241.1|  590|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL627402-5|CAH71238.1|  897|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL627402-4|CAH71237.1|  909|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL627402-3|CAH71239.1|  921|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL627402-2|CAH71240.1|  926|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL603754-6|CAI41638.1|  590|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL603754-5|CAI41637.1|  897|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL603754-4|CAI41634.1|  909|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL603754-3|CAI41636.1|  921|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL603754-2|CAI41635.1|  926|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL445239-7|CAI41096.1|  590|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL445239-6|CAI41095.1|  897|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL445239-5|CAI41092.1|  909|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL445239-4|CAI41094.1|  921|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL445239-3|CAI41093.1|  926|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL353691-7|CAI42248.1|  590|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL353691-6|CAI42247.1|  897|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL353691-5|CAI42244.1|  909|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL353691-4|CAI42246.1|  921|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL353691-3|CAI42245.1|  926|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL162581-2|CAI19518.1|  632|Homo sapiens RP1-132F22.1 protein.         37   0.075
AL158144-5|CAI42766.1|  590|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL158144-4|CAI42765.1|  897|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL158144-3|CAI42762.1|  909|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL158144-2|CAI42764.1|  921|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL158144-1|CAI42763.1|  926|Homo sapiens calcium/calmodulin-depe...    37   0.075
AL031178-1|CAI20261.1|  632|Homo sapiens RP1-132F22.1 protein.         37   0.075
AF262405-1|AAF72667.1|  871|Homo sapiens calcium/calmodulin-depe...    37   0.075
AF152469-1|AAG43364.1|  632|Homo sapiens MAK-related kinase prot...    37   0.075
AF035582-1|AAB88198.1|  897|Homo sapiens CASK protein.                 37   0.075
AF032119-1|AAB88125.1|  921|Homo sapiens hCASK protein.                37   0.075
AB208859-1|BAD92096.1|  917|Homo sapiens calcium/calmodulin-depe...    37   0.075
AB023153-1|BAA76780.2|  640|Homo sapiens KIAA0936 protein protein.     37   0.075
U43784-1|AAC50428.1|  382|Homo sapiens mitogen activated protein...    37   0.099
U09578-1|AAD09136.1|  382|Homo sapiens MAPKAP kinase protein.          37   0.099
D79997-1|BAA11492.2|  656|Homo sapiens KIAA0175 protein.               37   0.099
BC125272-1|AAI25273.1|  625|Homo sapiens MYO3A protein protein.        37   0.099
BC119811-1|AAI19812.1|  664|Homo sapiens MYO3A protein protein.        37   0.099
BC036079-1|AAH36079.1|  247|Homo sapiens MYO3A protein protein.        37   0.099
BC014611-1|AAH14611.1|  273|Homo sapiens testis-specific serine ...    37   0.099
BC014039-1|AAH14039.1|  651|Homo sapiens maternal embryonic leuc...    37   0.099
BC010407-1|AAH10407.1|  382|Homo sapiens mitogen-activated prote...    37   0.099
BC007591-1|AAH07591.1|  382|Homo sapiens mitogen-activated prote...    37   0.099
BC001662-1|AAH01662.1|  382|Homo sapiens mitogen-activated prote...    37   0.099
AY847283-1|AAW31760.1|  379|Homo sapiens cyclin-dependent kinase...    37   0.099
AY845084-1|AAW30008.1|  315|Homo sapiens cyclin-dependent kinase...    37   0.099
AY101367-1|AAM34500.1| 1616|Homo sapiens myosin IIIA protein.          37   0.099
AL442063-1|CAI16995.2|  651|Homo sapiens maternal embryonic leuc...    37   0.099
AL391812-1|CAI17380.1| 1616|Homo sapiens myosin IIIA protein.          37   0.099
AL360217-1|CAD13206.2| 1616|Homo sapiens myosin IIIA protein.          37   0.099
AL358612-3|CAH73816.1|  247|Homo sapiens myosin IIIA protein.          37   0.099
AL358612-2|CAH73815.1|  197|Homo sapiens myosin IIIA protein.          37   0.099
AL358612-1|CAH73814.1| 1616|Homo sapiens myosin IIIA protein.          37   0.099
AL354932-1|CAI11034.2|  651|Homo sapiens maternal embryonic leuc...    37   0.099
AL162724-8|CAH70253.1|  201|Homo sapiens NIMA (never in mitosis ...    37   0.099
AL162503-4|CAH73661.1| 1616|Homo sapiens myosin IIIA protein.          37   0.099
AL137846-12|CAI10882.1|  201|Homo sapiens NIMA (never in mitosis...    37   0.099
AK222811-1|BAD96531.1|  651|Homo sapiens maternal embryonic leuc...    37   0.099
AK172841-1|BAD18805.1|  406|Homo sapiens protein ( Homo sapiens ...    37   0.099
AF329483-1|AAK48827.1|  273|Homo sapiens serine/threonine protei...    37   0.099
AF229172-1|AAF70861.1| 1615|Homo sapiens class III myosin protein.     37   0.099
M34182-1|AAC41690.1|  360|Homo sapiens protein kinase A gamma-su...    36   0.13 
DQ667175-1|ABG25920.1|  351|Homo sapiens protein kinase, cAMP-de...    36   0.13 
DQ201638-1|ABA27097.1|  527|Homo sapiens oxidative-stress respon...    36   0.13 
CR542225-1|CAG47021.1|  372|Homo sapiens STK17B protein.               36   0.13 
BC117183-1|AAI17184.1|  926|Homo sapiens SNF1-like kinase 2 prot...    36   0.13 
BC113459-1|AAI13460.1|  926|Homo sapiens SNF1-like kinase 2 prot...    36   0.13 
BC039888-1|AAH39888.1|  351|Homo sapiens protein kinase, cAMP-de...    36   0.13 
BC032787-1|AAH32787.1|  476|Homo sapiens calcium/calmodulin-depe...    36   0.13 
BC008726-1|AAH08726.1|  527|Homo sapiens oxidative-stress respon...    36   0.13 
AY212935-1|AAP29964.1|  460|Homo sapiens CLICK III protein.            36   0.13 
AM231061-1|CAJ76912.1| 1960|Homo sapiens obscurin isoform B prot...    36   0.13 
AL162730-1|CAH71828.1|  351|Homo sapiens protein kinase, cAMP-de...    36   0.13 
AL049688-1|CAB41259.1|  481|Homo sapiens hypothetical protein pr...    36   0.13 
AL023754-3|CAI19991.1|  476|Homo sapiens calcium/calmodulin-depe...    36   0.13 
AL023754-2|CAI19990.1|  245|Homo sapiens calcium/calmodulin-depe...    36   0.13 
AJ001597-1|CAA04863.1|  351|Homo sapiens cAMP-dependent protein ...    36   0.13 
AF428261-1|AAL28100.1|  476|Homo sapiens calcium/calmodulin-depe...    36   0.13 
AB084424-1|BAB91442.1|  346|Homo sapiens KIAA0781 protein protein.     36   0.13 
AB018324-1|BAA34501.3|  950|Homo sapiens KIAA0781 protein protein.     36   0.13 
AB017642-1|BAA75674.1|  527|Homo sapiens oxidative-stress respon...    36   0.13 
U79240-1|AAB50198.1|  458|Homo sapiens serine/threonine protein ...    36   0.17 
BC126432-1|AAI26433.1|  454|Homo sapiens death-associated protei...    36   0.17 
BC126430-1|AAI26431.1|  454|Homo sapiens death-associated protei...    36   0.17 
AJ271722-1|CAB71146.1|  714|Homo sapiens putative serine/threoni...    36   0.17 
AF042838-1|AAC97073.1| 1495|Homo sapiens MEK kinase 1 protein.         36   0.17 
AB029024-1|BAA83053.2|  467|Homo sapiens KIAA1101 protein protein.     36   0.17 
AB022341-1|BAA81746.1|  454|Homo sapiens ZIP kinase protein.           36   0.17 
AB007144-1|BAA24955.1|  454|Homo sapiens ZIP-kinase protein.           36   0.17 
U23460-1|AAC99802.1|  664|Homo sapiens proline rich calmodulin-d...    36   0.23 
L41816-1|AAA99458.1|  370|Homo sapiens cam kinase I protein.           36   0.23 
D43636-1|BAA07744.2|  766|Homo sapiens KIAA0096 protein.               36   0.23 
CR542227-1|CAG47023.1|  431|Homo sapiens STK24 protein.                36   0.23 
CR533508-1|CAG38539.1|  473|Homo sapiens MGC8407 protein.              36   0.23 
BT019619-1|AAV38425.1|  431|Homo sapiens serine/threonine kinase...    36   0.23 
BC106755-1|AAI06756.1|  370|Homo sapiens calcium/calmodulin-depe...    36   0.23 
BC106754-1|AAI06755.1|  370|Homo sapiens calcium/calmodulin-depe...    36   0.23 
BC071567-1|AAH71567.1|  765|Homo sapiens SNRK protein protein.         36   0.23 
BC065378-1|AAH65378.1|  431|Homo sapiens serine/threonine kinase...    36   0.23 
BC047284-1|AAH47284.2|  471|Homo sapiens mitogen-activated prote...    36   0.23 
BC041049-1|AAH41049.1|  471|Homo sapiens mitogen-activated prote...    36   0.23 
BC035578-1|AAH35578.1|  431|Homo sapiens serine/threonine kinase...    36   0.23 
BC019256-1|AAH19256.1|  501|Homo sapiens CaM kinase-like vesicle...    36   0.23 
BC019070-1|AAH19070.1|  503|Homo sapiens calcium/calmodulin-depe...    36   0.23 
BC017363-1|AAH17363.1|  501|Homo sapiens CaM kinase-like vesicle...    36   0.23 
BC005828-1|AAH05828.1|  501|Homo sapiens CaM kinase-like vesicle...    36   0.23 
BC001921-1|AAH01921.1|  501|Homo sapiens CaM kinase-like vesicle...    36   0.23 
BC000833-1|AAH00833.1|  456|Homo sapiens Unknown (protein for IM...    36   0.23 
BC000497-1|AAH00497.1|  501|Homo sapiens CaM kinase-like vesicle...    36   0.23 
AL834498-1|CAD39156.1|  716|Homo sapiens hypothetical protein pr...    36   0.23 
AL356423-3|CAI13115.1|  431|Homo sapiens serine/threonine kinase...    36   0.23 
AL356423-2|CAI13114.1|  443|Homo sapiens serine/threonine kinase...    36   0.23 
AL137249-7|CAI39457.1|  431|Homo sapiens serine/threonine kinase...    36   0.23 
AL137249-3|CAI39453.1|  443|Homo sapiens serine/threonine kinase...    36   0.23 
AK222703-1|BAD96423.1|  542|Homo sapiens calcium/calmodulin-depe...    36   0.23 
AK075294-1|BAC11528.1|  470|Homo sapiens protein ( Homo sapiens ...    36   0.23 
AK074899-1|BAC11278.1|  470|Homo sapiens protein ( Homo sapiens ...    36   0.23 
AK074856-1|BAC11248.1|  501|Homo sapiens protein ( Homo sapiens ...    36   0.23 
AK000231-1|BAA91023.1|  244|Homo sapiens protein ( Homo sapiens ...    36   0.23 
AJ252238-1|CAB65122.1|  518|Homo sapiens calcium/calmodulin depe...    36   0.23 
AJ252237-1|CAB65121.1|  479|Homo sapiens calcium/calmodulin depe...    36   0.23 
AJ252236-1|CAB65120.1|  503|Homo sapiens calcium/calmodulin depe...    36   0.23 
AF140350-1|AAD42070.1|  449|Homo sapiens calcium/calmodulin-depe...    36   0.23 
AF083420-1|AAD42039.1|  443|Homo sapiens brain-specific STE20-li...    36   0.23 
AF083419-1|AAD42038.1|  517|Homo sapiens calcium/calmodulin-depe...    36   0.23 
AF081924-1|AAD42037.1|  492|Homo sapiens calcium/calmodulin-depe...    36   0.23 
AF081572-1|AAD42036.1|  503|Homo sapiens calcium/calmodulin-depe...    36   0.23 
AF078803-1|AAD42035.1|  542|Homo sapiens calcium/calmodulin-depe...    36   0.23 
AF032437-1|AAC39863.1|  471|Homo sapiens mitogen activated prote...    36   0.23 
AF024636-1|AAB82560.1|  431|Homo sapiens STE20-like kinase 3 pro...    36   0.23 
AC093748-1|AAY40983.1|  443|Homo sapiens unknown protein.              36   0.23 
AB209181-1|BAD92418.1|  796|Homo sapiens Hypothetical protein DK...    36   0.23 
CR542210-1|CAG47006.1|  372|Homo sapiens STK17B protein.               35   0.30 
BC112101-1|AAI12102.1|  979|Homo sapiens NIMA related kinase 9 p...    35   0.30 
BC093881-1|AAH93881.1|  979|Homo sapiens NIMA (never in mitosis ...    35   0.30 
BC045538-1|AAH45538.1|  247|Homo sapiens MYO3A protein protein.        35   0.30 
BC035354-1|AAH35354.1|  268|Homo sapiens testis-specific serine ...    35   0.30 
BC028603-1|AAH28603.1|  464|Homo sapiens serine/threonine kinase...    35   0.30 
BC016040-1|AAH16040.1|  372|Homo sapiens serine/threonine kinase...    35   0.30 
AY874862-1|AAX59898.1|  424|Homo sapiens SH3-binding kinase prot...    35   0.30 
AY080896-1|AAL87410.1|  979|Homo sapiens NIMA-family kinase NERC...    35   0.30 
AY048701-1|AAL02128.1|  268|Homo sapiens TSSK3 protein.                35   0.30 
AY048580-1|AAL05428.1|  979|Homo sapiens NIMA-related kinase Nek...    35   0.30 
AL109945-4|CAI22888.1|  268|Homo sapiens testis-specific serine ...    35   0.30 
AF296450-1|AAK97141.1|  268|Homo sapiens testis-specific serine/...    35   0.30 
AC114760-2|AAY14982.1|  372|Homo sapiens unknown protein.              35   0.30 
AC007055-5|AAD31940.1|  312|Homo sapiens protein ( Homo sapiens ...    35   0.30 
AB082526-1|BAC02704.1| 1011|Homo sapiens KIAA1995 protein protein.     35   0.30 
AB023182-1|BAA76809.2|  489|Homo sapiens KIAA0965 protein protein.     35   0.30 
AB011421-1|BAA34127.1|  372|Homo sapiens DRAK2 protein.                35   0.30 
Z98049-1|CAI20579.1|  733|Homo sapiens ribosomal protein S6 kina...    35   0.40 
Z93016-2|CAI19815.1|  487|Homo sapiens serine/threonine kinase 4...    35   0.40 
Z93016-1|CAB07508.2|  462|Homo sapiens serine/threonine kinase 4...    35   0.40 
Z85986-3|CAB39180.1|  465|Homo sapiens serine/threonine kinase 3...    35   0.40 
Z35102-1|CAA84485.1|  465|Homo sapiens Ndr protein kinase protein.     35   0.40 
X99325-1|CAA67700.1|  426|Homo sapiens Ste20-like kinase protein.      35   0.40 
X85106-1|CAA59427.1|  733|Homo sapiens ribosomal S6 kinase protein.    35   0.40 
U60207-1|AAB17262.1|  487|Homo sapiens serine/threonine protein ...    35   0.40 
U18297-1|AAA83254.1|  487|Homo sapiens MST1 protein.                   35   0.40 
U08316-1|AAA81952.1|  740|Homo sapiens insulin-stimulated protei...    35   0.40 
L07599-1|AAC82495.1|  580|Homo sapiens ribosomal protein S6 kina...    35   0.40 
L07598-1|AAC82496.1|  540|Homo sapiens ribosomal protein S6 kina...    35   0.40 
D63780-1|BAA20420.1|  426|Homo sapiens YSK1 protein.                   35   0.40 
D29767-1|BAA06171.1|  631|Homo sapiens Tec protein-tyrosine kina...    35   0.40 
DQ093965-1|AAY88740.1|  426|Homo sapiens serine/threonine kinase...    35   0.40 
BT019961-1|AAV38764.1|  426|Homo sapiens serine/threonine kinase...    35   0.40 
BC101713-1|AAI01714.1|  631|Homo sapiens tec protein tyrosine ki...    35   0.40 
BC101711-1|AAI01712.1|  631|Homo sapiens tec protein tyrosine ki...    35   0.40 
BC096303-1|AAH96303.1|  740|Homo sapiens ribosomal protein S6 ki...    35   0.40 
BC096302-1|AAH96302.1|  740|Homo sapiens ribosomal protein S6 ki...    35   0.40 
BC096301-1|AAH96301.1|  740|Homo sapiens ribosomal protein S6 ki...    35   0.40 
BC095413-1|AAH95413.1|  465|Homo sapiens serine/threonine kinase...    35   0.40 
BC093768-1|AAH93768.1|  487|Homo sapiens serine/threonine kinase...    35   0.40 
BC091505-1|AAH91505.1|  426|Homo sapiens STK25 protein protein.        35   0.40 
BC070077-1|AAH70077.1|  968|Homo sapiens serine/threonine kinase...    35   0.40 
BC058916-1|AAH58916.1|  405|Homo sapiens STK4 protein protein.         35   0.40 
BC029511-1|AAH29511.1|  405|Homo sapiens STK4 protein protein.         35   0.40 
BC015793-1|AAH15793.1|  426|Homo sapiens STK25 protein protein.        35   0.40 
BC015332-1|AAH15332.1|  405|Homo sapiens Unknown (protein for IM...    35   0.40 
BC012085-1|AAH12085.1|  465|Homo sapiens serine/threonine kinase...    35   0.40 
BC007852-1|AAH07852.1|  426|Homo sapiens serine/threonine kinase...    35   0.40 
BC002363-1|AAH02363.1|  733|Homo sapiens ribosomal protein S6 ki...    35   0.40 
AL807772-3|CAI39687.1|  740|Homo sapiens ribosomal protein S6 ki...    35   0.40 
AL807772-1|CAI39684.1|  227|Homo sapiens ribosomal protein S6 ki...    35   0.40 
AL732366-2|CAI40548.1|  740|Homo sapiens ribosomal protein S6 ki...    35   0.40 
AL109839-4|CAI95634.1|  487|Homo sapiens serine/threonine kinase...    35   0.40 
AL109839-3|CAI95633.1|  462|Homo sapiens serine/threonine kinase...    35   0.40 
AL022069-2|CAI19651.1|  733|Homo sapiens ribosomal protein S6 ki...    35   0.40 
AC110299-2|AAY14683.1|  426|Homo sapiens unknown protein.              35   0.40 
AB209315-1|BAD92552.1|  511|Homo sapiens serine/threonine kinase...    35   0.40 
AB209116-1|BAD92353.1|  806|Homo sapiens ribosomal protein S6 ki...    35   0.40 
AB208933-1|BAD92170.1|  806|Homo sapiens ribosomal protein S6 ki...    35   0.40 
AB102662-1|BAC81131.1|  726|Homo sapiens RPS6KA3 protein.              35   0.40 
AB001872-1|BAA24817.1|  966|Homo sapiens leucine zipper bearing ...    35   0.40 
Y15056-1|CAA75341.1|  556|Homo sapiens PkB kinase protein.             34   0.53 
CR536517-1|CAG38755.1|  556|Homo sapiens PDPK1 protein.                34   0.53 
BC047865-1|AAH47865.1|  812|Homo sapiens MAP4K2 protein protein.       34   0.53 
BC031231-1|AAH31231.1|  514|Homo sapiens serine/threonine kinase...    34   0.53 
BC012103-1|AAH12103.1|  556|Homo sapiens 3-phosphoinositide depe...    34   0.53 
BC001274-1|AAH01274.1|  324|Homo sapiens CDC2L5 protein protein.       34   0.53 
AY679523-1|AAT74623.1| 1512|Homo sapiens cell division cycle 2-l...    34   0.53 
AK093251-1|BAC04109.1|  514|Homo sapiens protein ( Homo sapiens ...    34   0.53 
AK025499-1|BAB15155.1|  872|Homo sapiens protein ( Homo sapiens ...    34   0.53 
AJ785968-1|CAH05056.1|  396|Homo sapiens PDPK2 protein protein.        34   0.53 
AJ303380-1|CAC29064.1|  514|Homo sapiens serine/threonine kinase...    34   0.53 
AJ297710-1|CAC10401.1| 1452|Homo sapiens CDC2L5 protein kinase p...    34   0.53 
AJ297709-1|CAC10400.1| 1512|Homo sapiens CDC2L5 protein kinase p...    34   0.53 
AF226044-1|AAF86944.1|  765|Homo sapiens HSNFRK protein.               34   0.53 
AF017995-1|AAC51825.1|  556|Homo sapiens 3-phosphoinositide depe...    34   0.53 
AC006023-1|AAD54514.1|  727|Homo sapiens WUGSC:H_DJ1147A01.1 pro...    34   0.53 
AC005591-1|AAC33797.1|  367|Homo sapiens PkB-like protein.             34   0.53 
AB209835-1|BAD93072.1|  492|Homo sapiens 3-phosphoinositide depe...    34   0.53 
Z84486-1|CAI21678.1|  526|Homo sapiens serum/glucocorticoid regu...    34   0.70 
Y10032-1|CAA71138.1|  431|Homo sapiens serine/threonine protein ...    34   0.70 
X85337-1|CAA59685.1|  991|Homo sapiens myosin light chain kinase...    34   0.70 
U78876-1|AAB41729.1|  626|Homo sapiens MEK kinase 3 protein.           34   0.70 
U35146-1|AAC50918.1|  493|Homo sapiens p56 KKIAMRE protein kinas...    34   0.70 
U07349-1|AAA20968.1|  819|Homo sapiens GC kinase protein.              34   0.70 
DQ454151-1|ABE11554.1|  622|Homo sapiens mitogen-activated prote...    34   0.70 
BC150265-1|AAI50266.1| 1481|Homo sapiens CRKRS protein protein.        34   0.70 
BC093981-1|AAH93981.1|  493|Homo sapiens cyclin-dependent kinase...    34   0.70 

>BC034988-1|AAH34988.1| 1036|Homo sapiens ULK2 protein protein.
          Length = 1036

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 26/79 (32%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ + +  H N + +Y      N+  +VM+Y +  DL + LQ KG LS   +   + Q
Sbjct: 56  EIKILKELQ-HENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQ 114

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH    IH D+K
Sbjct: 115 IAAAMRILHSKGIIHRDLK 133


>AB014523-1|BAA31598.2| 1100|Homo sapiens KIAA0623 protein protein.
          Length = 1100

 Score = 50.0 bits (114), Expect = 1e-05
 Identities = 26/79 (32%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ + +  H N + +Y      N+  +VM+Y +  DL + LQ KG LS   +   + Q
Sbjct: 120 EIKILKELQ-HENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQ 178

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH    IH D+K
Sbjct: 179 IAAAMRILHSKGIIHRDLK 197


>U66064-1|AAB80848.1|  315|Homo sapiens calcium/calmodulin-dependent
           protein kinase II protein.
          Length = 315

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>BC034044-1|AAH34044.1|  527|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 527

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AL713896-5|CAI13790.1|  529|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 529

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AL713896-4|CAI13789.1|  495|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 495

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AL713896-3|CAI13791.1|  527|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 527

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AL713896-2|CAI13788.1|  516|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 516

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AL596247-5|CAI13965.1|  529|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 529

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AL596247-4|CAI13966.1|  495|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 495

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AL596247-3|CAI13968.1|  527|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 527

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AL596247-2|CAI13967.1|  516|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 516

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 120 ILESVNHIHQHDIVHRDLK 138


>AF415197-1|AAM33514.1|  566|Homo sapiens
           calcium/calmodulin-dependent protein kinase II gamma
           protein.
          Length = 566

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q
Sbjct: 39  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQ 97

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N +H+H+ +H D+K
Sbjct: 98  ILESVNHIHQHDIVHRDLK 116


>AF054621-1|AAC25955.1|  309|Homo sapiens serine/threonine kinase
           AIE2 protein.
          Length = 309

 Score = 46.8 bits (106), Expect = 9e-05
 Identities = 24/79 (30%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+ H     HPN +++Y +        ++++Y    +L++ LQ   +L  Q  + II +
Sbjct: 93  EIQAHL---QHPNILRLYNHFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEE 149

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +AL   H    IH DIK
Sbjct: 150 LADALTYCHDKKVIHRDIK 168


>BC009107-1|AAH09107.1|  879|Homo sapiens microtubule associated
           serine/threonine kinase-like protein.
          Length = 879

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++  P  + +Y++    NN  +VM+Y+   D+   L I G    ++    I ++  AL+ 
Sbjct: 87  LSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDY 146

Query: 37  LHKHNFIHNDIK 2
           LH+H  IH D+K
Sbjct: 147 LHRHGIIHRDLK 158


>AL160291-7|CAI16908.1|  878|Homo sapiens novel protein kinase
           domain containing protein protein.
          Length = 878

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++  P  + +Y++    NN  +VM+Y+   D+   L I G    ++    I ++  AL+ 
Sbjct: 87  LSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDY 146

Query: 37  LHKHNFIHNDIK 2
           LH+H  IH D+K
Sbjct: 147 LHRHGIIHRDLK 158


>AL160291-6|CAI16909.1|  879|Homo sapiens novel protein kinase
           domain containing protein protein.
          Length = 879

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++  P  + +Y++    NN  +VM+Y+   D+   L I G    ++    I ++  AL+ 
Sbjct: 87  LSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDY 146

Query: 37  LHKHNFIHNDIK 2
           LH+H  IH D+K
Sbjct: 147 LHRHGIIHRDLK 158


>AL160291-5|CAI16910.1|  840|Homo sapiens novel protein kinase
           domain containing protein protein.
          Length = 840

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++  P  + +Y++    NN  +VM+Y+   D+   L I G    ++    I ++  AL+ 
Sbjct: 87  LSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDY 146

Query: 37  LHKHNFIHNDIK 2
           LH+H  IH D+K
Sbjct: 147 LHRHGIIHRDLK 158


>AK074804-1|BAC11218.1|  840|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90323 fis, clone NT2RP2001769, weakly similar to
           SERINE/THREONINE-PROTEIN KINASE ORB6 (EC 2.7.1.-). ).
          Length = 840

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++  P  + +Y++    NN  +VM+Y+   D+   L I G    ++    I ++  AL+ 
Sbjct: 87  LSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDY 146

Query: 37  LHKHNFIHNDIK 2
           LH+H  IH D+K
Sbjct: 147 LHRHGIIHRDLK 158


>AK027719-1|BAB55321.1|  878|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14813 fis, clone NT2RP4002408, moderately
           similar to PROTEIN KINASE CEK1 (EC 2.7.1.-). ).
          Length = 878

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/72 (29%), Positives = 38/72 (52%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           ++  P  + +Y++    NN  +VM+Y+   D+   L I G    ++    I ++  AL+ 
Sbjct: 87  LSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKSLLHIYGYFDEEMAVKYISEVALALDY 146

Query: 37  LHKHNFIHNDIK 2
           LH+H  IH D+K
Sbjct: 147 LHRHGIIHRDLK 158


>X90568-1|CAA62188.1|26926|Homo sapiens titin protein.
          Length = 26926

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208   HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDLH 32
             H N + ++ +   +   V++ ++I   D+FE +     EL+ + + + + Q+CEAL  LH
Sbjct: 24807 HRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEALQFLH 24866

Query: 31    KHNFIHNDIK 2
              HN  H DI+
Sbjct: 24867 SHNIGHFDIR 24876


>X69490-1|CAA49245.1| 4650|Homo sapiens titin protein.
          Length = 4650

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDLH 32
            H N + ++ +   +   V++ ++I   D+FE +     EL+ + + + + Q+CEAL  LH
Sbjct: 2531 HRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEALQFLH 2590

Query: 31   KHNFIHNDIK 2
             HN  H DI+
Sbjct: 2591 SHNIGHFDIR 2600


>X64697-1|CAA45938.1| 3100|Homo sapiens titin protein.
          Length = 3100

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDLH 32
            H N + ++ +   +   V++ ++I   D+FE +     EL+ + + + + Q+CEAL  LH
Sbjct: 2531 HRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEALQFLH 2590

Query: 31   KHNFIHNDIK 2
             HN  H DI+
Sbjct: 2591 SHNIGHFDIR 2600


>L07043-1|AAB61379.1|  306|Homo sapiens calcium/calmodulin-dependent
           protein kinase isoform A protein.
          Length = 306

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q+ E++N +H+
Sbjct: 3   HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQ 62

Query: 28  HNFIHNDIK 2
           H+ +H D+K
Sbjct: 63  HDIVHRDLK 71


>BC021269-1|AAH21269.2|  453|Homo sapiens CAMK2G protein protein.
          Length = 453

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q+ E++N +H+
Sbjct: 5   HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQ 64

Query: 28  HNFIHNDIK 2
           H+ +H D+K
Sbjct: 65  HDIVHRDLK 73


>AL713896-1|CAI13787.1|  453|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 453

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q+ E++N +H+
Sbjct: 5   HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQ 64

Query: 28  HNFIHNDIK 2
           H+ +H D+K
Sbjct: 65  HDIVHRDLK 73


>AL596247-1|CAI13964.1|  453|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II gamma protein.
          Length = 453

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +        +V D +   +LFE +  +   S    S+ I Q+ E++N +H+
Sbjct: 5   HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQ 64

Query: 28  HNFIHNDIK 2
           H+ +H D+K
Sbjct: 65  HDIVHRDLK 73


>AJ277892-1|CAD12455.1|26926|Homo sapiens N2B-Titin Isoform protein.
          Length = 26926

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208   HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIRQLCEALNDLH 32
             H N + ++ +   +   V++ ++I   D+FE +     EL+ + + + + Q+CEAL  LH
Sbjct: 24807 HRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEALQFLH 24866

Query: 31    KHNFIHNDIK 2
              HN  H DI+
Sbjct: 24867 SHNIGHFDIR 24876


>AF090421-1|AAC69577.1|  809|Homo sapiens ribosome S6 protein kinase
           protein.
          Length = 809

 Score = 46.0 bits (104), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L   HPN +K++       +  +VM+ ++  +LF+ L+ K   S    S I+R+
Sbjct: 468 EITALKLCEGHPNIVKLHEVFHDQLHTFLVMELLNGGELFDALRKKKHFSETEASYIMRK 527

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  AL+ +H    +H D+K
Sbjct: 528 LVSALSHMHDLGVVHRDLK 546



 Score = 33.1 bits (72), Expect = 1.2
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V + +   P  + +++         +++DYI+  +LF  L  +   +   V   + +
Sbjct: 101 ERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGE 160

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  LHK   I+ DIK
Sbjct: 161 IVLALEHLHKLGIIYRDIK 179


>BC075064-1|AAH75064.2|  275|Homo sapiens AURKC protein protein.
          Length = 275

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+ H     HPN +++Y          ++++Y    +L++ LQ   +L  Q  + II +
Sbjct: 59  EIQAHL---QHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEE 115

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +AL   H    IH DIK
Sbjct: 116 LADALTYCHDKKVIHRDIK 134


>AY714054-1|AAU04399.1|  306|Homo sapiens aurora-C protein.
          Length = 306

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+ H     HPN +++Y          ++++Y    +L++ LQ   +L  Q  + II +
Sbjct: 90  EIQAHL---QHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEE 146

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +AL   H    IH DIK
Sbjct: 147 LADALTYCHDKKVIHRDIK 165


>AY661554-1|AAT64422.1|  290|Homo sapiens aurora/Ipl1-related kinase
           3 transcript variant 1 protein.
          Length = 290

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+ H     HPN +++Y          ++++Y    +L++ LQ   +L  Q  + II +
Sbjct: 74  EIQAHL---QHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEE 130

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +AL   H    IH DIK
Sbjct: 131 LADALTYCHDKKVIHRDIK 149


>AK027302-1|BAB55026.1|  208|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14396 fis, clone HEMBA1003291, moderately
           similar to SNF1-RELATED PROTEIN KINASE KIN10 (EC
           2.7.1.-). ).
          Length = 208

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HP+ I IY      +  VI+M+Y    +L++ +  +  LS +   +  RQ
Sbjct: 103 EIEIMSSLN-HPHIISIYEVFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQ 161

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  HK+  +H D+K
Sbjct: 162 IVSAVHYCHKNGVVHRDLK 180


>AB017332-1|BAA76292.1|  309|Homo sapiens Aurora/Ipl1-related kinase
           3 protein.
          Length = 309

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+ H     HPN +++Y          ++++Y    +L++ LQ   +L  Q  + II +
Sbjct: 93  EIQAHL---QHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEE 149

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +AL   H    IH DIK
Sbjct: 150 LADALTYCHDKKVIHRDIK 168


>AB011109-1|BAA25463.2|  698|Homo sapiens KIAA0537 protein protein.
          Length = 698

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 43/79 (54%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HP+ I IY      +  VI+M+Y    +L++ +  +  LS +   +  RQ
Sbjct: 140 EIEIMSSLN-HPHIISIYEVFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQ 198

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  HK+  +H D+K
Sbjct: 199 IVSAVHYCHKNGVVHRDLK 217


>BC026158-1|AAH26158.1| 1315|Homo sapiens serine/threonine kinase
           36, fused homolog (Drosophila) protein.
          Length = 1315

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 24/69 (34%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +  +       V+V DY +  +LF+ L+  G+L    V  I  QL  AL  LH 
Sbjct: 60  HPNIVHMLDSFETDKEVVVVTDYAE-GELFQILEDDGKLPEDQVQAIAAQLVSALYYLHS 118

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 119 HRILHRDMK 127


>AF200815-1|AAF97028.1| 1315|Homo sapiens FUSED serine/threonine
           kinase protein.
          Length = 1315

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 24/69 (34%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +  +       V+V DY +  +LF+ L+  G+L    V  I  QL  AL  LH 
Sbjct: 60  HPNIVHMLDSFETDKEVVVVTDYAE-GELFQILEDDGKLPEDQVQAIAAQLVSALYYLHS 118

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 119 HRILHRDMK 127


>AB033104-1|BAA86592.1| 1311|Homo sapiens KIAA1278 protein protein.
          Length = 1311

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 24/69 (34%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +  +       V+V DY +  +LF+ L+  G+L    V  I  QL  AL  LH 
Sbjct: 77  HPNIVHMLDSFETDKEVVVVTDYAE-GELFQILEDDGKLPEDQVQAIAAQLVSALYYLHS 135

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 136 HRILHRDMK 144


>Z29067-1|CAA82310.1|  459|Homo sapiens protein kinase protein.
          Length = 459

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGEL-SHQLVSNIIRQLCEALNDL 35
           HPN +    +     +  IVM+Y D  DL + + Q KG+L    ++ N   Q+C  +N +
Sbjct: 12  HPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHI 71

Query: 34  HKHNFIHNDIK 2
           HK   +H DIK
Sbjct: 72  HKKRVLHRDIK 82


>X80590-1|CAA56681.1|  387|Homo sapiens phosphorylase kinase
           protein.
          Length = 387

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>BC109097-1|AAI09098.2|  795|Homo sapiens MLCK protein protein.
          Length = 795

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNII 65
           +EI +   ++ H N I++Y      ++  +VM+Y+D  +LF+ +   K  L+   V    
Sbjct: 535 NEINIMNQLS-HVNLIQLYDAFESKHSCTLVMEYVDGGELFDRITDEKYHLTELDVVLFT 593

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+CE ++ LH+H  +H D+K
Sbjct: 594 RQICEGVHYLHQHYILHLDLK 614


>BC074753-1|AAH74753.1|  387|Homo sapiens phosphorylase kinase,
           gamma 1 (muscle) protein.
          Length = 387

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>BC069754-1|AAH69754.1|  387|Homo sapiens phosphorylase kinase,
           gamma 1 (muscle) protein.
          Length = 387

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>BC069738-1|AAH69738.1|  387|Homo sapiens phosphorylase kinase,
           gamma 1 (muscle) protein.
          Length = 387

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>BC069679-1|AAH69679.1|  387|Homo sapiens phosphorylase kinase,
           gamma 1 (muscle) protein.
          Length = 387

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>BC051327-1|AAH51327.1|  387|Homo sapiens phosphorylase kinase,
           gamma 1 (muscle) protein.
          Length = 387

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>BC036422-1|AAH36422.1|  436|Homo sapiens hypothetical protein
           MGC42105 protein.
          Length = 436

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 21/69 (30%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I++Y     ++   +VM+Y    +LF  +  +G+LS      I  Q+  A+  +H+
Sbjct: 130 HPNIIRLYEVVETLSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHE 189

Query: 28  HNFIHNDIK 2
           +  IH D+K
Sbjct: 190 NQIIHRDLK 198


>BC019916-1|AAH19916.2|  506|Homo sapiens NIMA (never in mitosis
           gene a)-related kinase 3 protein.
          Length = 506

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGEL-SHQLVSNIIRQLCEALNDL 35
           HPN +    +     +  IVM+Y D  DL + + Q KG+L    ++ N   Q+C  +N +
Sbjct: 59  HPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHI 118

Query: 34  HKHNFIHNDIK 2
           HK   +H DIK
Sbjct: 119 HKKRVLHRDIK 129


>BC017306-1|AAH17306.1|  628|Homo sapiens NUAK family, SNF1-like
           kinase, 2 protein.
          Length = 628

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HP+ I I+      +  VIVM+Y    DL++ +  + +LS +   +  RQ
Sbjct: 100 EIEIMSSLN-HPHIIAIHEVFENSSKIVIVMEYASRGDLYDYISERQQLSEREARHFFRQ 158

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H++  +H D+K
Sbjct: 159 IVSAVHYCHQNRVVHRDLK 177


>BC017187-1|AAH17187.1|  549|Homo sapiens ribosomal protein S6
           kinase, 90kDa, polypeptide 5 protein.
          Length = 549

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L   HPN +K++       +  +VM+ ++  +LFE ++ K   S    S I+R+
Sbjct: 468 EITALKLCEGHPNIVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRK 527

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++ +H    +H D+K
Sbjct: 528 LVSAVSHMHDVGVVHRDLK 546



 Score = 33.1 bits (72), Expect = 1.2
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V + +   P  + +++         +++DYI+  +LF  L  +   +   V   + +
Sbjct: 101 ERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGE 160

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  LHK   I+ DIK
Sbjct: 161 IVLALEHLHKLGIIYRDIK 179


>AL139082-7|CAI12895.1|  507|Homo sapiens NIMA (never in mitosis
           gene a)-related kinase 3 protein.
          Length = 507

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGEL-SHQLVSNIIRQLCEALNDL 35
           HPN +    +     +  IVM+Y D  DL + + Q KG+L    ++ N   Q+C  +N +
Sbjct: 59  HPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHI 118

Query: 34  HKHNFIHNDIK 2
           HK   +H DIK
Sbjct: 119 HKKRVLHRDIK 129


>AK131359-1|BAD18511.1|  510|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16392 fis, clone TRACH2020048, moderately
           similar to Mus musculus serine/threonine-protein kinase
           NEK3 (Nek3) mRNA. ).
          Length = 510

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGEL-SHQLVSNIIRQLCEALNDL 35
           HPN +    +     +  IVM+Y D  DL + + Q KG+L    ++ N   Q+C  +N +
Sbjct: 80  HPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHI 139

Query: 34  HKHNFIHNDIK 2
           HK   +H DIK
Sbjct: 140 HKKRVLHRDIK 150


>AK074830-1|BAC11234.1|  628|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90349 fis, clone NT2RP2003179, weakly similar to
           PUTATIVE SERINE/THREONINE-PROTEIN KINASE EMK (EC
           2.7.1.-). ).
          Length = 628

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +N HP+ I I+      +  VIVM+Y    DL++ +  + +LS +   +  RQ
Sbjct: 100 EIEIMSSLN-HPHIIAIHEVFENSSKIVIVMEYASRGDLYDYISERQQLSEREARHFFRQ 158

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H++  +H D+K
Sbjct: 159 IVSAVHYCHQNRVVHRDLK 177


>AJ247087-1|CAC42766.1|  795|Homo sapiens myosin light chain kinase
           (MLCK) protein.
          Length = 795

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNII 65
           +EI +   ++ H N I++Y      ++  +VM+Y+D  +LF+ +   K  L+   V    
Sbjct: 535 NEINIMNQLS-HVNLIQLYDAFESKHSCTLVMEYVDGGELFDRITDEKYHLTELDVVLFT 593

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+CE ++ LH+H  +H D+K
Sbjct: 594 RQICEGVHYLHQHYILHLDLK 614


>AF254253-1|AAL36972.1|  387|Homo sapiens phosphorylase kinase gamma
           protein.
          Length = 387

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>AF080000-1|AAD23915.1|  802|Homo sapiens RSK-like protein kinase
           RLPK protein.
          Length = 802

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L   HPN +K++       +  +VM+ ++  +LFE ++ K   S    S I+R+
Sbjct: 468 EITALKLCEGHPNIVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRK 527

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++ +H    +H D+K
Sbjct: 528 LVSAVSHMHDVGVVHRDLK 546



 Score = 33.1 bits (72), Expect = 1.2
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V + +   P  + +++         +++DYI+  +LF  L  +   +   V   + +
Sbjct: 101 ERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGE 160

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  LHK   I+ DIK
Sbjct: 161 IVLALEHLHKLGIIYRDIK 179


>AF074393-1|AAC31171.1|  802|Homo sapiens nuclear mitogen- and
           stress-activated protein kinase-1 protein.
          Length = 802

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L   HPN +K++       +  +VM+ ++  +LFE ++ K   S    S I+R+
Sbjct: 468 EITALKLCEGHPNIVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRK 527

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++ +H    +H D+K
Sbjct: 528 LVSAVSHMHDVGVVHRDLK 546



 Score = 33.1 bits (72), Expect = 1.2
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V + +   P  + +++         +++DYI+  +LF  L  +   +   V   + +
Sbjct: 101 ERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGE 160

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL  LHK   I+ DIK
Sbjct: 161 IVLALEHLHKLGIIYRDIK 179


>AC092101-3|AAS07453.1|  387|Homo sapiens unknown protein.
          Length = 387

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + ++ HPN I++   +       +V D +   +LF+ L  K  LS +    I+R 
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRA 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +  LHK N +H D+K
Sbjct: 134 LLEVICTLHKLNIVHRDLK 152


>AB072828-1|BAC15599.1|  489|Homo sapiens NIMA-related protein
           kinase 3 protein.
          Length = 489

 Score = 44.8 bits (101), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGEL-SHQLVSNIIRQLCEALNDL 35
           HPN +    +     +  IVM+Y D  DL + + Q KG+L    ++ N   Q+C  +N +
Sbjct: 59  HPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHI 118

Query: 34  HKHNFIHNDIK 2
           HK   +H DIK
Sbjct: 119 HKKRVLHRDIK 129


>AF059681-1|AAC77369.1|  275|Homo sapiens serine/threonine kinase 13
           protein.
          Length = 275

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+ H     HPN +++Y          ++++Y    +L++ LQ   +L  Q  + II +
Sbjct: 59  EIQAHL---QHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEE 115

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + +AL   H    IH DIK
Sbjct: 116 VADALTYCHDKKVIHRDIK 134


>AY505125-1|AAS86443.1|  696|Homo sapiens protein kinase SAD-A
           protein.
          Length = 696

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 66  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H H+  H D+K
Sbjct: 125 IISALDFCHSHSICHRDLK 143


>AY166857-1|AAN87839.1|  668|Homo sapiens serine/threonine protein
           kinase isoform protein.
          Length = 668

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 66  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H H+  H D+K
Sbjct: 125 IISALDFCHSHSICHRDLK 143


>AK131534-1|BAD18671.1|  766|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16763 fis, clone BRAMY3018357, weakly  similar
           to SNF1-related protein kinase KIN10 (EC 2.7.1.-). ).
          Length = 766

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 112 EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 170

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H H+  H D+K
Sbjct: 171 IISALDFCHSHSICHRDLK 189


>AF533880-1|AAP97727.1|  674|Homo sapiens putative serine/threonine
           protein kinase variant B3 protein.
          Length = 674

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 66  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H H+  H D+K
Sbjct: 125 IISALDFCHSHSICHRDLK 143


>AF533879-1|AAP97726.1|  736|Homo sapiens putative serine/threonine
           protein kinase variant C protein.
          Length = 736

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 66  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H H+  H D+K
Sbjct: 125 IISALDFCHSHSICHRDLK 143


>AF533878-1|AAP97725.1|  674|Homo sapiens putative serine/threonine
           protein kinase variant B2 protein.
          Length = 674

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 66  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H H+  H D+K
Sbjct: 125 IISALDFCHSHSICHRDLK 143


>AF533877-1|AAP97724.1|  674|Homo sapiens putative serine/threonine
           protein kinase variant B1 protein.
          Length = 674

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 66  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H H+  H D+K
Sbjct: 125 IISALDFCHSHSICHRDLK 143


>AF533876-1|AAP97723.1|  668|Homo sapiens putative serine/threonine
           protein kinase variant A protein.
          Length = 668

 Score = 44.0 bits (99), Expect = 7e-04
 Identities = 22/79 (27%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 66  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H H+  H D+K
Sbjct: 125 IISALDFCHSHSICHRDLK 143


>Y11950-1|CAA72694.1|  406|Homo sapiens phosphorylase kinase gamma
           subunit protein.
          Length = 406

 Score = 43.6 bits (98), Expect = 9e-04
 Identities = 22/69 (31%), Positives = 39/69 (56%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ I +  ++   +   +V D +   +LF+ L  K  LS +   +I+R L EA++ LH 
Sbjct: 87  HPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHA 146

Query: 28  HNFIHNDIK 2
           +N +H D+K
Sbjct: 147 NNIVHRDLK 155


>M31606-1|AAA36442.1|  406|Homo sapiens phosphorylase kinase
           protein.
          Length = 406

 Score = 43.6 bits (98), Expect = 9e-04
 Identities = 22/69 (31%), Positives = 39/69 (56%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ I +  ++   +   +V D +   +LF+ L  K  LS +   +I+R L EA++ LH 
Sbjct: 87  HPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHA 146

Query: 28  HNFIHNDIK 2
           +N +H D+K
Sbjct: 147 NNIVHRDLK 155


>BC132833-1|AAI32834.1|  388|Homo sapiens hypothetical protein
           LOC340156 protein.
          Length = 388

 Score = 43.6 bits (98), Expect = 9e-04
 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNII 65
           +EI V   + DH N I++Y      N+ V+VM+Y+D  +LF+ +  +   L+       +
Sbjct: 150 NEISVMNQL-DHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFM 208

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+CE +  +H+   +H D+K
Sbjct: 209 KQICEGIRHMHQMYILHLDLK 229


>BC132831-1|AAI32832.1|  388|Homo sapiens hypothetical protein
           LOC340156 protein.
          Length = 388

 Score = 43.6 bits (98), Expect = 9e-04
 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNII 65
           +EI V   + DH N I++Y      N+ V+VM+Y+D  +LF+ +  +   L+       +
Sbjct: 150 NEISVMNQL-DHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFM 208

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+CE +  +H+   +H D+K
Sbjct: 209 KQICEGIRHMHQMYILHLDLK 229


>BC002541-1|AAH02541.1|  406|Homo sapiens phosphorylase kinase,
           gamma 2 (testis) protein.
          Length = 406

 Score = 43.6 bits (98), Expect = 9e-04
 Identities = 22/69 (31%), Positives = 39/69 (56%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ I +  ++   +   +V D +   +LF+ L  K  LS +   +I+R L EA++ LH 
Sbjct: 87  HPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHA 146

Query: 28  HNFIHNDIK 2
           +N +H D+K
Sbjct: 147 NNIVHRDLK 155


>AL139092-1|CAH73662.1|  388|Homo sapiens protein ( Human DNA
           sequence from clone RP11-420G6 on chromosome 6 Contains 
           the WRNIP1 gene for Werner helicase interacting protein
           1, the  ).
          Length = 388

 Score = 43.6 bits (98), Expect = 9e-04
 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNII 65
           +EI V   + DH N I++Y      N+ V+VM+Y+D  +LF+ +  +   L+       +
Sbjct: 150 NEISVMNQL-DHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFM 208

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+CE +  +H+   +H D+K
Sbjct: 209 KQICEGIRHMHQMYILHLDLK 229


>AL138876-2|CAI12221.2|  388|Homo sapiens protein ( Human DNA
           sequence from clone RP11-145H9 on chromosome 6 Contains 
           part of a gene for a novel protein similar to myosin
           light chain  ).
          Length = 388

 Score = 43.6 bits (98), Expect = 9e-04
 Identities = 24/81 (29%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNII 65
           +EI V   + DH N I++Y      N+ V+VM+Y+D  +LF+ +  +   L+       +
Sbjct: 150 NEISVMNQL-DHANLIQLYDAFESKNDIVLVMEYVDGGELFDRIIDESYNLTELDTILFM 208

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+CE +  +H+   +H D+K
Sbjct: 209 KQICEGIRHMHQMYILHLDLK 229


>AK131198-1|BAD18393.1|  706|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16039 fis, clone ADRGL2001554, weakly  similar
           to SERINE/THREONINE-PROTEIN KINASE PLK (EC 2.7.1.-). ).
          Length = 706

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/81 (27%), Positives = 43/81 (53%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           + EI++HQ + DHP+  K+Y +        ++++      L   L+++  L+   V   +
Sbjct: 85  MSEIRIHQSL-DHPHICKMYKHFEDNRYHYLILELCSNETLAHLLRVRECLTEPEVQYFL 143

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
            Q+ +A++ LHK   IH D+K
Sbjct: 144 LQIIDAVSYLHKRCIIHRDLK 164


>AY120867-1|AAM55491.1|  752|Homo sapiens MAP/microtubule
           affinity-regulating kinase-like 1 protein.
          Length = 752

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + +N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 106 EVRIMKGLN-HPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQ 164

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H+ N +H D+K
Sbjct: 165 IVSAVHYCHQKNIVHRDLK 183


>AY057448-1|AAL23683.1|  752|Homo sapiens MARK4 serine/threonine
           protein kinase protein.
          Length = 752

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + +N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 106 EVRIMKGLN-HPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQ 164

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H+ N +H D+K
Sbjct: 165 IVSAVHYCHQKNIVHRDLK 183


>AK075272-1|BAC11510.1|  752|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90791 fis, clone THYRO1001593, moderately
           similar to PUTATIVE SERINE/THREONINE-PROTEIN KINASE P78
           (EC 2.7.1.-). ).
          Length = 752

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + +N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 106 EVRIMKGLN-HPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQ 164

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H+ N +H D+K
Sbjct: 165 IVSAVHYCHQKNIVHRDLK 183


>AJ006701-1|CAA07196.1|  603|Homo sapiens putative serine/threonine
           protein kinase protein.
          Length = 603

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 19/70 (27%), Positives = 38/70 (54%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ+  AL+  H
Sbjct: 3   EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCH 62

Query: 31  KHNFIHNDIK 2
            H+  H D+K
Sbjct: 63  SHSICHRDLK 72


>AF045458-1|AAC32326.1| 1050|Homo sapiens serine/threonine kinase
           ULK1 protein.
          Length = 1050

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ + +  H N + +Y      N+  +VM+Y +  DL + L     LS   +   ++Q
Sbjct: 63  EIKILKELK-HENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQ 121

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH    IH D+K
Sbjct: 122 IAGAMRLLHSKGIIHRDLK 140


>AB088047-1|BAC03375.1|  752|Homo sapiens microtubule
           affinity-regulating kinase-like1 protein.
          Length = 752

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + +N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 106 EVRIMKGLN-HPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQ 164

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H+ N +H D+K
Sbjct: 165 IVSAVHYCHQKNIVHRDLK 183


>AB058763-1|BAB47489.1|  689|Homo sapiens KIAA1860 protein protein.
          Length = 689

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + +N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 107 EVRIMKGLN-HPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQ 165

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H+ N +H D+K
Sbjct: 166 IVSAVHYCHQKNIVHRDLK 184


>AB049127-1|BAB39380.1|  688|Homo sapiens MAP/microtubule
           affinity-regulating kinase like 1 protein.
          Length = 688

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + +N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 106 EVRIMKGLN-HPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQ 164

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A++  H+ N +H D+K
Sbjct: 165 IVSAVHYCHQKNIVHRDLK 183


>AB018265-1|BAA34442.2| 1066|Homo sapiens KIAA0722 protein protein.
          Length = 1066

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ + +  H N + +Y      N+  +VM+Y +  DL + L     LS   +   ++Q
Sbjct: 79  EIKILKELK-HENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQ 137

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+  LH    IH D+K
Sbjct: 138 IAGAMRLLHSKGIIHRDLK 156


>U64205-1|AAC15093.1|  729|Homo sapiens Cdc25C associated protein
           kinase C-TAK1 protein.
          Length = 729

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 18/79 (22%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          ++M+Y    ++F+ L   G +  +   +  RQ
Sbjct: 103 EVRIMKILN-HPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQ 161

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 162 IVSAVQYCHQKRIVHRDLK 180


>BC024773-1|AAH24773.1|  729|Homo sapiens MAP/microtubule
           affinity-regulating kinase 3 protein.
          Length = 729

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 18/79 (22%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          ++M+Y    ++F+ L   G +  +   +  RQ
Sbjct: 103 EVRIMKILN-HPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQ 161

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 162 IVSAVQYCHQKRIVHRDLK 180


>AF387637-1|AAK82367.1|  744|Homo sapiens Ser/Thr protein kinase
           PAR-1A protein.
          Length = 744

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 18/79 (22%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          ++M+Y    ++F+ L   G +  +   +  RQ
Sbjct: 103 EVRIMKILN-HPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQ 161

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 162 IVSAVQYCHQKRIVHRDLK 180


>U22456-1|AAA64850.1|  174|Homo sapiens AMP-activated protein kinase
           homolog protein.
          Length = 174

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  +VM+Y+   +LF+ +   G L  +    + +Q+   ++  H+
Sbjct: 49  HPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHR 108

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 109 HMVVHRDLK 117


>U06454-1|AAA64745.1|  552|Homo sapiens AMP-activated protein kinase
           protein.
          Length = 552

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y       +  +VM+Y+   +LF+ +   G +       + +Q+  A++  H+
Sbjct: 73  HPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHR 132

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 133 HMVVHRDLK 141


>EF056019-1|ABK30810.1|  552|Homo sapiens AMP-activated alpha 2
           subunit protein.
          Length = 552

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y       +  +VM+Y+   +LF+ +   G +       + +Q+  A++  H+
Sbjct: 73  HPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHR 132

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 133 HMVVHRDLK 141


>BC069823-1|AAH69823.1|  552|Homo sapiens AMP-activated protein
           kinase alpha 2 catalytic subunit protein.
          Length = 552

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y       +  +VM+Y+   +LF+ +   G +       + +Q+  A++  H+
Sbjct: 73  HPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHR 132

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 133 HMVVHRDLK 141


>BC069740-1|AAH69740.1|  552|Homo sapiens AMP-activated protein
           kinase alpha 2 catalytic subunit protein.
          Length = 552

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y       +  +VM+Y+   +LF+ +   G +       + +Q+  A++  H+
Sbjct: 73  HPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHR 132

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 133 HMVVHRDLK 141


>BC069680-1|AAH69680.1|  552|Homo sapiens protein kinase,
           AMP-activated, alpha 2 catalytic subunit protein.
          Length = 552

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y       +  +VM+Y+   +LF+ +   G +       + +Q+  A++  H+
Sbjct: 73  HPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHR 132

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 133 HMVVHRDLK 141


>BC037303-1|AAH37303.1|  550|Homo sapiens PRKAA1 protein protein.
          Length = 550

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  +VM+Y+   +LF+ +   G L  +    + +Q+   ++  H+
Sbjct: 75  HPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHR 134

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 135 HMVVHRDLK 143


>BC012622-1|AAH12622.1|  207|Homo sapiens PRKAA1 protein protein.
          Length = 207

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  +VM+Y+   +LF+ +   G L  +    + +Q+   ++  H+
Sbjct: 75  HPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHR 134

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 135 HMVVHRDLK 143


>AL035705-2|CAC17574.2|  552|Homo sapiens protein kinase,
           AMP-activated, alpha 2 catalytic subunit protein.
          Length = 552

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y       +  +VM+Y+   +LF+ +   G +       + +Q+  A++  H+
Sbjct: 73  HPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHR 132

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 133 HMVVHRDLK 141


>AB022017-1|BAA36547.1|  550|Homo sapiens AMP-activated protein
           kinase alpha-1 protein.
          Length = 550

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 18/69 (26%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  +VM+Y+   +LF+ +   G L  +    + +Q+   ++  H+
Sbjct: 75  HPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHR 134

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 135 HMVVHRDLK 143


>BC032784-1|AAH32784.1|  478|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II delta protein.
          Length = 478

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/79 (25%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I+Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N  H +  +H D+K
Sbjct: 120 ILESVNHCHLNGIVHRDLK 138


>AY987011-1|AAX88806.1|  489|Homo sapiens
           calcium/calmodulin-dependent protein kinase II delta
           protein.
          Length = 489

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/79 (25%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I+Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N  H +  +H D+K
Sbjct: 120 ILESVNHCHLNGIVHRDLK 138


>AY505124-1|AAS86442.1|  778|Homo sapiens protein kinase SAD-B
           protein.
          Length = 778

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 81  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 139

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H ++  H D+K
Sbjct: 140 IVSALDFCHSYSICHRDLK 158


>AY458602-1|AAS10354.1|  778|Homo sapiens SAD1 kinase protein.
          Length = 778

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 81  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 139

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H ++  H D+K
Sbjct: 140 IVSALDFCHSYSICHRDLK 158


>AJ252239-1|CAB65123.1|  243|Homo sapiens calcium/calmodulin
           dependent protein kinase II delta protein.
          Length = 243

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/79 (25%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I+Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N  H +  +H D+K
Sbjct: 120 ILESVNHCHLNGIVHRDLK 138


>AF479827-1|AAL87698.1|  778|Homo sapiens protein kinase-like
           protein protein.
          Length = 778

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 81  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 139

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H ++  H D+K
Sbjct: 140 IVSALDFCHSYSICHRDLK 158


>AF479826-1|AAL87697.1|  794|Homo sapiens putative serine/threonine
           protein kinase protein.
          Length = 794

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 97  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 155

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H ++  H D+K
Sbjct: 156 IVSALDFCHSYSICHRDLK 174


>AF164041-1|AAD50272.1| 1130|Homo sapiens WARTS protein kinase
           protein.
          Length = 1130

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 23/70 (32%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +++Y++    +N   VMDYI   D+   L   G     L    I +L  A+  +H
Sbjct: 761 DNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVH 820

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 821 KMGFIHRDIK 830


>AF104413-1|AAD16882.1| 1130|Homo sapiens large tumor suppressor 1
           protein.
          Length = 1130

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 23/70 (32%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +++Y++    +N   VMDYI   D+   L   G     L    I +L  A+  +H
Sbjct: 761 DNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVH 820

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 821 KMGFIHRDIK 830


>AF071569-1|AAD20442.1|  499|Homo sapiens multifunctional
           calcium/calmodulin-dependent protein kinase II delta2
           isoform protein.
          Length = 499

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/79 (25%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I+Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N  H +  +H D+K
Sbjct: 120 ILESVNHCHLNGIVHRDLK 138


>AB209426-1|BAD92663.1|  830|Homo sapiens LATS homolog 1 variant
           protein.
          Length = 830

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 23/70 (32%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +++Y++    +N   VMDYI   D+   L   G     L    I +L  A+  +H
Sbjct: 613 DNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVH 672

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 673 KMGFIHRDIK 682


>AB209288-1|BAD92525.1|  522|Homo sapiens
           calcium/calmodulin-dependent protein kinase II delta
           isoform 1 variant protein.
          Length = 522

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 20/79 (25%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I+Q
Sbjct: 91  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ 149

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E++N  H +  +H D+K
Sbjct: 150 ILESVNHCHLNGIVHRDLK 168


>AB058714-1|BAB47440.1|  715|Homo sapiens KIAA1811 protein protein.
          Length = 715

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 21/79 (26%), Positives = 44/79 (55%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+ +HP+ +K++  +       +V++++   +LF+ L  KG L+ +      RQ
Sbjct: 18  EIAILKLI-EHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQ 76

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  AL+  H ++  H D+K
Sbjct: 77  IVSALDFCHSYSICHRDLK 95


>M80359-1|AAA59991.1|  713|Homo sapiens protein p78 protein.
          Length = 713

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 18/79 (22%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          ++M+Y     +F+ L   G +  +   +  RQ
Sbjct: 103 EVRIMKILN-HPNIVKLFEVIETQKTLYLIMEYASGGKVFDYLVAHGRMKEKEARSKFRQ 161

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 162 IVSAVQYCHQKRIVHRDLK 180


>BT019534-1|AAV38341.1|  344|Homo sapiens serine/threonine kinase 12
           protein.
          Length = 344

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EI++   ++ HPN +++Y N+ +   ++ ++++Y    +L++ LQ       Q  + I+ 
Sbjct: 125 EIEIQAHLH-HPNILRLY-NYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIME 182

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L +AL   H    IH DIK
Sbjct: 183 ELADALMYCHGKKVIHRDIK 202


>BC080581-1|AAH80581.1|  344|Homo sapiens aurora kinase B protein.
          Length = 344

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EI++   ++ HPN +++Y N+ +   ++ ++++Y    +L++ LQ       Q  + I+ 
Sbjct: 125 EIEIQAHLH-HPNILRLY-NYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIME 182

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L +AL   H    IH DIK
Sbjct: 183 ELADALMYCHGKKVIHRDIK 202


>BC038504-1|AAH38504.1|  783|Homo sapiens SNF1-like kinase protein.
          Length = 783

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/79 (27%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +L+N HP+ IK+Y      +   IV ++    ++F+ L   G LS         Q
Sbjct: 74  EVQLMKLLN-HPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQ 132

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H H+ +H D+K
Sbjct: 133 ILSAVEYCHDHHIVHRDLK 151


>BC013300-1|AAH13300.2|  371|Homo sapiens AURKB protein protein.
          Length = 371

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EI++   ++ HPN +++Y N+ +   ++ ++++Y    +L++ LQ       Q  + I+ 
Sbjct: 152 EIEIQAHLH-HPNILRLY-NYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIME 209

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L +AL   H    IH DIK
Sbjct: 210 ELADALMYCHGKKVIHRDIK 229


>BC009751-1|AAH09751.1|  344|Homo sapiens aurora kinase B protein.
          Length = 344

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EI++   ++ HPN +++Y N+ +   ++ ++++Y    +L++ LQ       Q  + I+ 
Sbjct: 125 EIEIQAHLH-HPNILRLY-NYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIME 182

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L +AL   H    IH DIK
Sbjct: 183 ELADALMYCHGKKVIHRDIK 202


>BC000442-1|AAH00442.3|  344|Homo sapiens aurora kinase B protein.
          Length = 344

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EI++   ++ HPN +++Y N+ +   ++ ++++Y    +L++ LQ       Q  + I+ 
Sbjct: 125 EIEIQAHLH-HPNILRLY-NYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIME 182

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L +AL   H    IH DIK
Sbjct: 183 ELADALMYCHGKKVIHRDIK 202


>AP001751-1|BAA95536.1|  786|Homo sapiens SNF1LK protein.
          Length = 786

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/79 (27%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +L+N HP+ IK+Y      +   IV ++    ++F+ L   G LS         Q
Sbjct: 74  EVQLMKLLN-HPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQ 132

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H H+ +H D+K
Sbjct: 133 ILSAVEYCHDHHIVHRDLK 151


>AK131076-1|BAC85126.1|  764|Homo sapiens FLJ00263 protein protein.
          Length = 764

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/79 (27%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +L+N HP+ IK+Y      +   IV ++    ++F+ L   G LS         Q
Sbjct: 55  EVQLMKLLN-HPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQ 113

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H H+ +H D+K
Sbjct: 114 ILSAVEYCHDHHIVHRDLK 132


>AF465413-1|AAL69982.1|  753|Homo sapiens MAP/microtubule
           affinity-regulating kinase 3 long isoform protein.
          Length = 753

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 18/79 (22%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          ++M+Y     +F+ L   G +  +   +  RQ
Sbjct: 103 EVRIMKILN-HPNIVKLFEVIETEKTLYLIMEYASGGKVFDYLVAHGRMKEKEARSKFRQ 161

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 162 IVSAVQYCHQKRIVHRDLK 180


>AF008552-1|AAC12709.1|  344|Homo sapiens aurora-related kinase 2
           protein.
          Length = 344

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EI++   ++ HPN +++Y N+ +   ++ ++++Y    +L++ LQ       Q  + I+ 
Sbjct: 125 EIEIQAHLH-HPNILRLY-NYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIME 182

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L +AL   H    IH DIK
Sbjct: 183 ELADALMYCHGKKVIHRDIK 202


>AB047786-1|BAD74070.1|  783|Homo sapiens serine/threonine protein
           kinase protein.
          Length = 783

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/79 (27%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +L+N HP+ IK+Y      +   IV ++    ++F+ L   G LS         Q
Sbjct: 74  EVQLMKLLN-HPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGHLSENEARKKFWQ 132

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H H+ +H D+K
Sbjct: 133 ILSAVEYCHDHHIVHRDLK 151


>AB011450-1|BAA32136.1|  344|Homo sapiens aurora and IPL1-like
           midbody-associated protein kinase-1 protein.
          Length = 344

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EI++   ++ HPN +++Y N+ +   ++ ++++Y    +L++ LQ       Q  + I+ 
Sbjct: 125 EIEIQAHLH-HPNILRLY-NYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIME 182

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L +AL   H    IH DIK
Sbjct: 183 ELADALMYCHGKKVIHRDIK 202


>AB011446-1|BAA82709.1|  343|Homo sapiens Aik2 protein.
          Length = 343

 Score = 41.1 bits (92), Expect = 0.005
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           EI++   ++ HPN +++Y N+ +   ++ ++++Y    +L++ LQ       Q  + I+ 
Sbjct: 125 EIEIQAHLH-HPNILRLY-NYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIME 182

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           +L +AL   H    IH DIK
Sbjct: 183 ELADALMYCHGKKVIHRDIK 202


>L24959-1|AAA18251.1|  473|Homo sapiens calcium/calmodulin dependent
           protein kinase protein.
          Length = 473

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN IK+           +V++ +   +LF+ +  KG  S +  ++ ++Q+ EA+  LH+
Sbjct: 98  HPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHE 157

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 158 NGIVHRDLK 166


>L17000-1|AAA35639.1|  473|Homo sapiens calcium/calmodulin-dependent
           protein kinase protein.
          Length = 473

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN IK+           +V++ +   +LF+ +  KG  S +  ++ ++Q+ EA+  LH+
Sbjct: 98  HPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHE 157

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 158 NGIVHRDLK 166


>D30742-1|BAA06403.1|  473|Homo sapiens calmodulin-dependent protein
           kinase IV protein.
          Length = 473

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN IK+           +V++ +   +LF+ +  KG  S +  ++ ++Q+ EA+  LH+
Sbjct: 98  HPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHE 157

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 158 NGIVHRDLK 166


>BC114478-1|AAI14479.1|  795|Homo sapiens MARK1 protein protein.
          Length = 795

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 107 EVRIMKILN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 165

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 166 IVSAVQYCHQKYIVHRDLK 184


>BC113869-1|AAI13870.1|  795|Homo sapiens MARK1 protein protein.
          Length = 795

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 107 EVRIMKILN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 165

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 166 IVSAVQYCHQKYIVHRDLK 184


>BC025687-1|AAH25687.1|  473|Homo sapiens
           calcium/calmodulin-dependent protein kinase IV protein.
          Length = 473

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN IK+           +V++ +   +LF+ +  KG  S +  ++ ++Q+ EA+  LH+
Sbjct: 98  HPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHE 157

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 158 NGIVHRDLK 166


>BC016695-1|AAH16695.2|  503|Homo sapiens CAMK4 protein protein.
          Length = 503

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN IK+           +V++ +   +LF+ +  KG  S +  ++ ++Q+ EA+  LH+
Sbjct: 128 HPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHE 187

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 188 NGIVHRDLK 196


>AL592406-3|CAH72463.1|  795|Homo sapiens MAP/microtubule
           affinity-regulating kinase 1 protein.
          Length = 795

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 107 EVRIMKILN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 165

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 166 IVSAVQYCHQKYIVHRDLK 184


>AF154845-1|AAF72103.1|  795|Homo sapiens MARK protein.
          Length = 795

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 107 EVRIMKILN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 165

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 166 IVSAVQYCHQKYIVHRDLK 184


>AB051552-1|BAB21856.1|  608|Homo sapiens KIAA1765 protein protein.
          Length = 608

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 20/79 (25%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + Q ++ HPN +K++  +       ++++Y+   DLF+ +    +      + +I  
Sbjct: 362 EILIIQSLS-HPNIVKLHEVYETDMEIYLILEYVQGGDLFDAIIESVKFPEPDAALMIMD 420

Query: 58  LCEALNDLHKHNFIHNDIK 2
           LC+AL  +H  + +H D+K
Sbjct: 421 LCKALVHMHDKSIVHRDLK 439


>X66358-1|CAA47002.1|  358|Homo sapiens serine/threonine protein
           kinase protein.
          Length = 358

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 22/69 (31%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +V +Y D   L E  + +  +   LV +I  Q  +A+N  HK
Sbjct: 61  HPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHK 120

Query: 28  HNFIHNDIK 2
           HN IH D+K
Sbjct: 121 HNCIHRDVK 129


>D86968-1|BAA13204.2| 1626|Homo sapiens KIAA0213 protein.
          Length = 1626

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1407 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1463

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1464 QITIAINVLHEHGIVHRDIK 1483


>BC146770-1|AAI46771.1| 1558|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1558

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1339 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1395

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1396 QITIAINVLHEHGIVHRDIK 1415


>BC104977-1|AAI04978.1|  358|Homo sapiens cyclin-dependent
           kinase-like 1 (CDC2-related kinase) protein.
          Length = 358

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 22/69 (31%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +V +Y D   L E  + +  +   LV +I  Q  +A+N  HK
Sbjct: 61  HPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHK 120

Query: 28  HNFIHNDIK 2
           HN IH D+K
Sbjct: 121 HNCIHRDVK 129


>BC069655-1|AAH69655.1|  390|Homo sapiens PHKG1 protein protein.
          Length = 390

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKI---YFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           E+ + + ++ HPN I++   Y  + F      +   +   +LF+ L  K  LS +    I
Sbjct: 74  EVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLFHRMKRGELFDYLTEKATLSEKETRKI 133

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +R L E +  LHK N +H D+K
Sbjct: 134 MRALLEVICTLHKLNIVHRDLK 155


>AY525548-1|AAS00095.1|  358|Homo sapiens cyclin-dependent
           kinase-like 1 (CDC2-related kinase) protein.
          Length = 358

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 22/69 (31%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +V +Y D   L E  + +  +   LV +I  Q  +A+N  HK
Sbjct: 61  HPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHK 120

Query: 28  HNFIHNDIK 2
           HN IH D+K
Sbjct: 121 HNCIHRDVK 129


>AL596452-3|CAI41309.1| 1498|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1498

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1339 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1395

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1396 QITIAINVLHEHGIVHRDIK 1415


>AL596452-2|CAI41310.1| 1544|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1544

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1385 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1441

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1442 QITIAINVLHEHGIVHRDIK 1461


>AL591045-2|CAH70639.1| 1498|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1498

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1339 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1395

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1396 QITIAINVLHEHGIVHRDIK 1415


>AL591045-1|CAH70640.1| 1544|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1544

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1385 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1441

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1442 QITIAINVLHEHGIVHRDIK 1461


>AL139393-2|CAI20815.1| 1498|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1498

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1339 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1395

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1396 QITIAINVLHEHGIVHRDIK 1415


>AL139393-1|CAI20816.1| 1544|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1544

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1385 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1441

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1442 QITIAINVLHEHGIVHRDIK 1461


>AL109942-4|CAI21477.1| 1498|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1498

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1339 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1395

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1396 QITIAINVLHEHGIVHRDIK 1415


>AL109942-3|CAC12766.2| 1544|Homo sapiens mitogen-activated protein
            kinase kinase kinase 4 protein.
          Length = 1544

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1385 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1441

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1442 QITIAINVLHEHGIVHRDIK 1461


>AF002715-1|AAB68804.1| 1607|Homo sapiens MAP kinase kinase kinase
            protein.
          Length = 1607

 Score = 40.3 bits (90), Expect = 0.008
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            DE+K+ + +  HPN ++ +          I M+Y D   L E  ++   L   ++    +
Sbjct: 1388 DELKIFEGIK-HPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLG--LQEHVIRLYSK 1444

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            Q+  A+N LH+H  +H DIK
Sbjct: 1445 QITIAINVLHEHGIVHRDIK 1464


>X97630-1|CAA66229.1|  745|Homo sapiens serine/threonine protein
           kinase protein.
          Length = 745

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 67  EVRIMKVLN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 126 IVSAVQYCHQKFIVHRDLK 144


>D84212-1|BAA23592.1|  402|Homo sapiens aurora/IPL1-related kinase
           protein.
          Length = 402

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +N+  ++  AL+  H 
Sbjct: 189 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTANLYNRIANALSYCHS 248

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 249 KRVIHRDIK 257


>BT007342-1|AAP36006.1|  755|Homo sapiens MAP/microtubule
           affinity-regulating kinase 2 protein.
          Length = 755

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 67  EVRIMKVLN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 126 IVSAVQYCHQKFIVHRDLK 144


>BC084540-1|AAH84540.1|  724|Homo sapiens MAP/microtubule
           affinity-regulating kinase 2 protein.
          Length = 724

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 100 EVRIMKVLN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 158

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 159 IVSAVQYCHQKFIVHRDLK 177


>BC040457-1|AAH40457.1|  478|Homo sapiens
           calcium/calmodulin-dependent protein kinase (CaM kinase)
           II alpha protein.
          Length = 478

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +     +  ++ D +   +LFE +  +   S    S+ I+Q
Sbjct: 60  EARICRLLK-HPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQ 118

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EA+   H+   +H D+K
Sbjct: 119 ILEAVLHCHQMGVVHRDLK 137


>BC035745-1|AAH35745.1|  385|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 385

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>BC008771-1|AAH08771.2|  778|Homo sapiens MARK2 protein protein.
          Length = 778

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 90  EVRIMKVLN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 148

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 149 IVSAVQYCHQKFIVHRDLK 167


>AL731559-2|CAI14675.1|  385|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 385

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AL731559-1|CAI14674.1|  357|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 357

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AL512783-2|CAH74036.1|  385|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 385

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AL512783-1|CAH74035.1|  357|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 357

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AL512284-2|CAH71694.1|  385|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 385

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AL512284-1|CAH71693.1|  357|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 357

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AL391314-2|CAI14410.1|  385|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 385

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AL391314-1|CAI14409.1|  357|Homo sapiens
           calcium/calmodulin-dependent protein kinase ID protein.
          Length = 357

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AF387638-1|AAK82368.1|  691|Homo sapiens Ser/Thr protein kinase
           PAR-1Balpha protein.
          Length = 691

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 67  EVRIMKVLN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 126 IVSAVQYCHQKFIVHRDLK 144


>AF286366-1|AAG00534.1|  357|Homo sapiens CamKI-like protein kinase
           protein.
          Length = 357

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AF145711-1|AAD30559.1|  489|Homo sapiens
           calcium/calmodulin-dependent protein kinase II alpha-B
           subunit protein.
          Length = 489

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +     +  ++ D +   +LFE +  +   S    S+ I+Q
Sbjct: 60  EARICRLLK-HPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQ 118

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EA+   H+   +H D+K
Sbjct: 119 ILEAVLHCHQMGVVHRDLK 137


>AF145710-1|AAD30558.1|  478|Homo sapiens
           calcium/calmodulin-dependent protein kinase II alpha
           subunit protein.
          Length = 478

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +     +  ++ D +   +LFE +  +   S    S+ I+Q
Sbjct: 60  EARICRLLK-HPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQ 118

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EA+   H+   +H D+K
Sbjct: 119 ILEAVLHCHQMGVVHRDLK 137


>AF091486-1|AAD55815.1|  478|Homo sapiens calmodulin-dependent
           protein kinase II alpha protein.
          Length = 478

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +     +  ++ D +   +LFE +  +   S    S+ I+Q
Sbjct: 60  EARICRLLK-HPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQ 118

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EA+   H+   +H D+K
Sbjct: 119 ILEAVLHCHQMGVVHRDLK 137


>AB188493-1|BAD37141.1|  719|Homo sapiens serine/threonine kinase
           protein.
          Length = 719

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++N HPN +K++          +VM+Y    ++F+ L   G +  +      RQ
Sbjct: 100 EVRIMKVLN-HPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQ 158

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   +H D+K
Sbjct: 159 IVSAVQYCHQKFIVHRDLK 177


>AB081726-1|BAC19846.1|  385|Homo sapiens CaM-kinase I delta
           protein.
          Length = 385

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N + +   +   N+  +VM  +   +LF+ +  KG  + +  S +IRQ+ +A+  LH+
Sbjct: 78  HENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHR 137

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 138 MGIVHRDLK 146


>AB023185-1|BAA76812.1|  527|Homo sapiens KIAA0968 protein protein.
          Length = 527

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 19/79 (24%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +     +  ++ D +   +LFE +  +   S    S+ I+Q
Sbjct: 109 EARICRLLK-HPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQ 167

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EA+   H+   +H D+K
Sbjct: 168 ILEAVLHCHQMGVVHRDLK 186


>U66464-1|AAB97983.1|  833|Homo sapiens hematopoietic progenitor
           kinase protein.
          Length = 833

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 19/69 (27%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N +  + ++ ++    I M++     L +  Q+ G LS   +S + R++ + L  LH 
Sbjct: 71  HANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHS 130

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 131 QKKIHRDIK 139


>BC127622-1|AAI27623.1|  596|Homo sapiens myosin light chain kinase
           2, skeletal muscle protein.
          Length = 596

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIR 62
           EI+V   +N H N I++Y      +  V+ M+YI+  +LFE +  +   L+       +R
Sbjct: 330 EIEVMNQLN-HRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVR 388

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+C+ +  +HK   +H D+K
Sbjct: 389 QICDGILFMHKMRVLHLDLK 408


>BC092413-1|AAH92413.1|  596|Homo sapiens myosin light chain kinase
           2, skeletal muscle protein.
          Length = 596

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIR 62
           EI+V   +N H N I++Y      +  V+ M+YI+  +LFE +  +   L+       +R
Sbjct: 330 EIEVMNQLN-HRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVR 388

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+C+ +  +HK   +H D+K
Sbjct: 389 QICDGILFMHKMRVLHLDLK 408


>BC069627-1|AAH69627.1|  596|Homo sapiens skeletal myosin light
           chain kinase protein.
          Length = 596

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIR 62
           EI+V   +N H N I++Y      +  V+ M+YI+  +LFE +  +   L+       +R
Sbjct: 330 EIEVMNQLN-HRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVR 388

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+C+ +  +HK   +H D+K
Sbjct: 389 QICDGILFMHKMRVLHLDLK 408


>AL160175-10|CAC10006.1|  596|Homo sapiens myosin light chain kinase
           2, skeletal muscle protein.
          Length = 596

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIR 62
           EI+V   +N H N I++Y      +  V+ M+YI+  +LFE +  +   L+       +R
Sbjct: 330 EIEVMNQLN-HRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVR 388

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+C+ +  +HK   +H D+K
Sbjct: 389 QICDGILFMHKMRVLHLDLK 408


>AJ272502-1|CAC81354.1|  596|Homo sapiens skeletal muscle-specific
           myosin light chain kinase protein.
          Length = 596

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIR 62
           EI+V   +N H N I++Y      +  V+ M+YI+  +LFE +  +   L+       +R
Sbjct: 330 EIEVMNQLN-HRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVR 388

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+C+ +  +HK   +H D+K
Sbjct: 389 QICDGILFMHKMRVLHLDLK 408


>AF325549-1|AAK15494.1|  596|Homo sapiens skeletal myosin light
           chain kinase protein.
          Length = 596

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIR 62
           EI+V   +N H N I++Y      +  V+ M+YI+  +LFE +  +   L+       +R
Sbjct: 330 EIEVMNQLN-HRNLIQLYAAIETPHEIVLFMEYIEGGELFERIVDEDYHLTEVDTMVFVR 388

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+C+ +  +HK   +H D+K
Sbjct: 389 QICDGILFMHKMRVLHLDLK 408


>AB062450-1|BAB85632.1|  302|Homo sapiens NEK7 protein.
          Length = 302

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI----KGELSHQLV 77
           + EI + + +N HPN IK Y +    N   IV++  D  DL   ++     K  +  + V
Sbjct: 80  IKEIDLLKQLN-HPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTV 138

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
                QLC AL  +H    +H DIK
Sbjct: 139 WKYFVQLCSALEHMHSRRVMHRDIK 163


>X75346-1|CAA53094.1|  396|Homo sapiens MAP kinase activated protein
           kinase-2 protein.
          Length = 396

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 35/155 (22%), Positives = 72/155 (46%), Gaps = 15/155 (9%)
 Frame = -3

Query: 421 PPPPPQMYAANAGTILRKLQKRQNSV*NNQRAFWQNIYFIAQAH*QIVF---AENNFGAN 251
           PPPPPQ +      +   LQ ++N++ ++ +   Q +          +F    +  F   
Sbjct: 32  PPPPPQQFPQFH--VKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALK 89

Query: 250 FNVD------EIKVHQLMNDHPNFIKIY--FNHGFINNQ--VIVMDYIDCPDLFETLQIK 101
              D      E+++H   +  P+ ++I   + + +   +  +IVM+ +D  +LF  +Q +
Sbjct: 90  MLQDCPKARREVELHWRASQCPDIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR 149

Query: 100 GE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G+   + +  S I++ + EA+  LH  N  H D+K
Sbjct: 150 GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVK 184


>U12779-1|AAA20851.1|  370|Homo sapiens MAP kinase activated protein
           kinase 2 protein.
          Length = 370

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 35/155 (22%), Positives = 72/155 (46%), Gaps = 15/155 (9%)
 Frame = -3

Query: 421 PPPPPQMYAANAGTILRKLQKRQNSV*NNQRAFWQNIYFIAQAH*QIVF---AENNFGAN 251
           PPPPPQ +      +   LQ ++N++ ++ +   Q +          +F    +  F   
Sbjct: 36  PPPPPQQFPQFH--VKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALK 93

Query: 250 FNVD------EIKVHQLMNDHPNFIKIY--FNHGFINNQ--VIVMDYIDCPDLFETLQIK 101
              D      E+++H   +  P+ ++I   + + +   +  +IVM+ +D  +LF  +Q +
Sbjct: 94  MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR 153

Query: 100 GE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G+   + +  S I++ + EA+  LH  N  H D+K
Sbjct: 154 GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVK 188


>D86959-1|BAA13195.2| 1164|Homo sapiens KIAA0204 protein protein.
          Length = 1164

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 99  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 158

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 159 HDNKIIHRDLK 169


>BC111565-1|AAI11566.1| 1204|Homo sapiens SLK protein protein.
          Length = 1204

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>BC064804-1|AAH64804.1|  617|Homo sapiens SLK protein protein.
          Length = 617

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>BC052584-1|AAH52584.1|  400|Homo sapiens mitogen-activated protein
           kinase-activated protein kinase 2 protein.
          Length = 400

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 35/155 (22%), Positives = 72/155 (46%), Gaps = 15/155 (9%)
 Frame = -3

Query: 421 PPPPPQMYAANAGTILRKLQKRQNSV*NNQRAFWQNIYFIAQAH*QIVF---AENNFGAN 251
           PPPPPQ +      +   LQ ++N++ ++ +   Q +          +F    +  F   
Sbjct: 36  PPPPPQQFPQFH--VKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALK 93

Query: 250 FNVD------EIKVHQLMNDHPNFIKIY--FNHGFINNQ--VIVMDYIDCPDLFETLQIK 101
              D      E+++H   +  P+ ++I   + + +   +  +IVM+ +D  +LF  +Q +
Sbjct: 94  MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR 153

Query: 100 GE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G+   + +  S I++ + EA+  LH  N  H D+K
Sbjct: 154 GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVK 188


>BC047885-1|AAH47885.1|  426|Homo sapiens SLK protein protein.
          Length = 426

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>BC047762-1|AAH47762.1|  614|Homo sapiens SLK protein protein.
          Length = 614

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>BC036060-1|AAH36060.2|  400|Homo sapiens mitogen-activated protein
           kinase-activated protein kinase 2 protein.
          Length = 400

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 35/155 (22%), Positives = 72/155 (46%), Gaps = 15/155 (9%)
 Frame = -3

Query: 421 PPPPPQMYAANAGTILRKLQKRQNSV*NNQRAFWQNIYFIAQAH*QIVF---AENNFGAN 251
           PPPPPQ +      +   LQ ++N++ ++ +   Q +          +F    +  F   
Sbjct: 36  PPPPPQQFPQFH--VKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALK 93

Query: 250 FNVD------EIKVHQLMNDHPNFIKIY--FNHGFINNQ--VIVMDYIDCPDLFETLQIK 101
              D      E+++H   +  P+ ++I   + + +   +  +IVM+ +D  +LF  +Q +
Sbjct: 94  MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR 153

Query: 100 GE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G+   + +  S I++ + EA+  LH  N  H D+K
Sbjct: 154 GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVK 188


>BC027464-1|AAH27464.1|  403|Homo sapiens aurora kinase A protein.
          Length = 403

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>BC006423-1|AAH06423.1|  403|Homo sapiens aurora kinase A protein.
          Length = 403

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>BC002499-1|AAH02499.1|  403|Homo sapiens AURKA protein protein.
          Length = 403

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>BC001280-1|AAH01280.1|  403|Homo sapiens aurora kinase A protein.
          Length = 403

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>AL591846-12|CAI13544.1|  400|Homo sapiens mitogen-activated protein
           kinase-activated protein kinase 2 protein.
          Length = 400

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 35/155 (22%), Positives = 72/155 (46%), Gaps = 15/155 (9%)
 Frame = -3

Query: 421 PPPPPQMYAANAGTILRKLQKRQNSV*NNQRAFWQNIYFIAQAH*QIVF---AENNFGAN 251
           PPPPPQ +      +   LQ ++N++ ++ +   Q +          +F    +  F   
Sbjct: 36  PPPPPQQFPQFH--VKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALK 93

Query: 250 FNVD------EIKVHQLMNDHPNFIKIY--FNHGFINNQ--VIVMDYIDCPDLFETLQIK 101
              D      E+++H   +  P+ ++I   + + +   +  +IVM+ +D  +LF  +Q +
Sbjct: 94  MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR 153

Query: 100 GE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G+   + +  S I++ + EA+  LH  N  H D+K
Sbjct: 154 GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVK 188


>AL591846-11|CAI13543.1|  370|Homo sapiens mitogen-activated protein
           kinase-activated protein kinase 2 protein.
          Length = 370

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 35/155 (22%), Positives = 72/155 (46%), Gaps = 15/155 (9%)
 Frame = -3

Query: 421 PPPPPQMYAANAGTILRKLQKRQNSV*NNQRAFWQNIYFIAQAH*QIVF---AENNFGAN 251
           PPPPPQ +      +   LQ ++N++ ++ +   Q +          +F    +  F   
Sbjct: 36  PPPPPQQFPQFH--VKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALK 93

Query: 250 FNVD------EIKVHQLMNDHPNFIKIY--FNHGFINNQ--VIVMDYIDCPDLFETLQIK 101
              D      E+++H   +  P+ ++I   + + +   +  +IVM+ +D  +LF  +Q +
Sbjct: 94  MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR 153

Query: 100 GE--LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           G+   + +  S I++ + EA+  LH  N  H D+K
Sbjct: 154 GDQAFTEREASEIMKSIGEAIQYLHSINIAHRDVK 188


>AL360170-2|CAH70404.1| 1235|Homo sapiens Ste20-related
           serine\/threonine kinase (SLK) protein.
          Length = 1235

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>AL360170-1|CAH70403.1| 1204|Homo sapiens Ste20-related
           serine\/threonine kinase (SLK) protein.
          Length = 1204

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>AL138761-2|CAI12395.1| 1235|Homo sapiens Ste20-related
           serine\/threonine kinase (SLK) protein.
          Length = 1235

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>AL138761-1|CAI12396.1| 1204|Homo sapiens Ste20-related
           serine\/threonine kinase (SLK) protein.
          Length = 1204

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>AL121914-5|CAI19324.1|  271|Homo sapiens aurora kinase A protein.
          Length = 271

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>AL121914-4|CAM45838.1|  347|Homo sapiens aurora kinase A protein.
          Length = 347

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>AL121914-3|CAC12717.1|  403|Homo sapiens aurora kinase A protein.
          Length = 403

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>AF273048-1|AAG34908.1| 1235|Homo sapiens CTCL tumor antigen se20-9
           protein.
          Length = 1235

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>AF195947-1|AAF29508.1|  403|Homo sapiens STK15 serine/threonine
           kinase protein.
          Length = 403

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>AF011468-1|AAC63902.1|  403|Homo sapiens serine/threonine kinase
           protein.
          Length = 403

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>AF008551-1|AAC12708.1|  403|Homo sapiens aurora-related kinase 1
           protein.
          Length = 403

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++Y          ++++Y     ++  LQ   +   Q  +  I +L  AL+  H 
Sbjct: 190 HPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 249

Query: 28  HNFIHNDIK 2
              IH DIK
Sbjct: 250 KRVIHRDIK 258


>AB011422-1|BAA76314.1| 1289|Homo sapiens Trad protein.
          Length = 1289

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
            HP +I ++  +    + +++++ +D   L + L    EL  + V+  IR + EAL  LH 
Sbjct: 1040 HPQYITLHDTYESPTSYILILELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHN 1099

Query: 28   HNFIHNDIK 2
                H DIK
Sbjct: 1100 CRVAHLDIK 1108


>AB002804-1|BAA19655.1| 1204|Homo sapiens hSLK protein.
          Length = 1204

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFET-LQIKGELSHQLVSNIIRQLCEALNDL 35
           DHPN +K+     + NN  I++++     +    L+++  L+   +  + +Q  +ALN L
Sbjct: 87  DHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYL 146

Query: 34  HKHNFIHNDIK 2
           H +  IH D+K
Sbjct: 147 HDNKIIHRDLK 157


>BC114491-1|AAI14492.1| 1189|Homo sapiens NEK1 protein protein.
          Length = 1189

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQ-LVSNIIRQLCEALNDL 35
           HPN ++   +     +  IVMDY +  DLF+ +   KG L  +  + +   Q+C AL  +
Sbjct: 60  HPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHV 119

Query: 34  HKHNFIHNDIK 2
           H    +H DIK
Sbjct: 120 HDRKILHRDIK 130


>BC022558-1|AAH22558.1|  344|Homo sapiens CAMK2D protein protein.
          Length = 344

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E ++ +L+  HPN ++++ +        +V D +   +LFE +  +   S    S+ I+Q
Sbjct: 61  EARICRLLK-HPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + EA+   H+   +H D+K
Sbjct: 120 ILEAVLHCHQMGVVHRDLK 138


>BC015147-1|AAH15147.1|  403|Homo sapiens Unknown (protein for
           IMAGE:4063881) protein.
          Length = 403

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQ-LVSNIIRQLCEALNDL 35
           HPN ++   +     +  IVMDY +  DLF+ +   KG L  +  + +   Q+C AL  +
Sbjct: 60  HPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHV 119

Query: 34  HKHNFIHNDIK 2
           H    +H DIK
Sbjct: 120 HDRKILHRDIK 130


>AL390029-2|CAI15721.1|  740|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 740

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 445 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 504

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 505 LNIVHRDIK 513


>AL390029-1|CAI15720.1|  729|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 729

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 445 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 504

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 505 LNIVHRDIK 513


>AL356285-1|CAI15861.1| 1088|Homo sapiens LATS, large tumor
           suppressor, homolog 2 (Drosophila) protein.
          Length = 1088

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 22/70 (31%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +K+Y++    ++   VMDYI   D+   L         L    I +L  A+  +H
Sbjct: 724 DNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVH 783

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 784 KMGFIHRDIK 793


>AL161613-1|CAH71526.1| 1088|Homo sapiens LATS, large tumor
           suppressor, homolog 2 (Drosophila) protein.
          Length = 1088

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 22/70 (31%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +K+Y++    ++   VMDYI   D+   L         L    I +L  A+  +H
Sbjct: 724 DNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVH 783

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 784 KMGFIHRDIK 793


>AL160392-2|CAH70261.1|  740|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 740

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 445 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 504

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 505 LNIVHRDIK 513


>AL160392-1|CAH70262.1|  729|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 729

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 445 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 504

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 505 LNIVHRDIK 513


>AL157760-4|CAH70170.1|  433|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 433

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 138 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 197

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 198 LNIVHRDIK 206


>AL157760-2|CAH70167.1|  740|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 740

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 445 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 504

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 505 LNIVHRDIK 513


>AL157760-1|CAH70168.1|  729|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 729

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 445 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 504

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 505 LNIVHRDIK 513


>AL157694-2|CAH70656.1|  740|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 740

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 445 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 504

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 505 LNIVHRDIK 513


>AL157694-1|CAH70657.1|  729|Homo sapiens doublecortin and CaM
           kinase-like 1 protein.
          Length = 729

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 445 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 504

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 505 LNIVHRDIK 513


>AF207547-1|AAF80561.1| 1088|Homo sapiens serine/threonine kinase
           KPM protein.
          Length = 1088

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 22/70 (31%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +K+Y++    ++   VMDYI   D+   L         L    I +L  A+  +H
Sbjct: 724 DNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVH 783

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 784 KMGFIHRDIK 793


>AB209897-1|BAD93134.1|  924|Homo sapiens LATS, large tumor
           suppressor, homolog 2 variant protein.
          Length = 924

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 22/70 (31%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +K+Y++    ++   VMDYI   D+   L         L    I +L  A+  +H
Sbjct: 730 DNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVH 789

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 790 KMGFIHRDIK 799


>AB067488-1|BAB67794.1| 1265|Homo sapiens KIAA1901 protein protein.
          Length = 1265

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQ-LVSNIIRQLCEALNDL 35
           HPN ++   +     +  IVMDY +  DLF+ +   KG L  +  + +   Q+C AL  +
Sbjct: 67  HPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHV 126

Query: 34  HKHNFIHNDIK 2
           H    +H DIK
Sbjct: 127 HDRKILHRDIK 137


>AB028019-1|BAA92381.1| 1046|Homo sapiens large tumor suppressor 2
           protein.
          Length = 1046

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 22/70 (31%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D+   +K+Y++    ++   VMDYI   D+   L         L    I +L  A+  +H
Sbjct: 682 DNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVH 741

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 742 KMGFIHRDIK 751


>AB002367-1|BAA20824.2|  794|Homo sapiens KIAA0369 protein.
          Length = 794

 Score = 38.7 bits (86), Expect = 0.025
 Identities = 18/69 (26%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + +           +VM+ +   DLF+ +    + + +  S ++  L  A+  LH 
Sbjct: 510 HPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHS 569

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 570 LNIVHRDIK 578


>Z25434-1|CAA80921.1|  114|Homo sapiens protein-serine/threonine
           kinase protein.
          Length = 114

 Score = 38.3 bits (85), Expect = 0.032
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETL-QIKGEL-SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + M+Y D  DL + + Q KG+L    ++ N   Q+C  +N +HK   +H DIK
Sbjct: 2   LYMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIK 54


>BC113705-1|AAI13706.1|  692|Homo sapiens NIMA (never in mitosis
           gene a)- related kinase 8 protein.
          Length = 692

 Score = 38.3 bits (85), Expect = 0.032
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSNI 68
           +E +V +L+N HPN I+ Y N       +I M+Y     L E +Q +    L  + + + 
Sbjct: 50  NECQVLKLLN-HPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHF 108

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
             Q+  AL+ +H H  +H D+K
Sbjct: 109 FVQILLALHHVHTHLILHRDLK 130


>BC112240-1|AAI12241.1|  692|Homo sapiens NIMA-related kinase 8
           protein.
          Length = 692

 Score = 38.3 bits (85), Expect = 0.032
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSNI 68
           +E +V +L+N HPN I+ Y N       +I M+Y     L E +Q +    L  + + + 
Sbjct: 50  NECQVLKLLN-HPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHF 108

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
             Q+  AL+ +H H  +H D+K
Sbjct: 109 FVQILLALHHVHTHLILHRDLK 130


>AY267371-1|AAP04006.1|  692|Homo sapiens NIMA-family kinase NEK8
           protein.
          Length = 692

 Score = 38.3 bits (85), Expect = 0.032
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSNI 68
           +E +V +L+N HPN I+ Y N       +I M+Y     L E +Q +    L  + + + 
Sbjct: 50  NECQVLKLLN-HPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHF 108

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
             Q+  AL+ +H H  +H D+K
Sbjct: 109 FVQILLALHHVHTHLILHRDLK 130


>AY242354-1|AAO88243.1|  692|Homo sapiens NIMA-related kinase 12a
           protein.
          Length = 692

 Score = 38.3 bits (85), Expect = 0.032
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSNI 68
           +E +V +L+N HPN I+ Y N       +I M+Y     L E +Q +    L  + + + 
Sbjct: 50  NECQVLKLLN-HPNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHF 108

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
             Q+  AL+ +H H  +H D+K
Sbjct: 109 FVQILLALHHVHTHLILHRDLK 130


>U85755-1|AAD00575.1|  299|Homo sapiens serum-inducible kinase
           protein.
          Length = 299

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++H++++ H + ++ Y       N  I+++Y     +   L+ +  L+   V   +RQ
Sbjct: 21  EIELHRILH-HKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQ 79

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L  LH+   +H D+K
Sbjct: 80  IVSGLKYLHEQEILHRDLK 98


>CR542222-1|CAG47018.1|  306|Homo sapiens NEK6 protein.
          Length = 306

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 84  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 141

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 142 VWKYFVQLCSAVEHMHSRRVMHRDIK 167


>CR457091-1|CAG33372.1|  306|Homo sapiens NEK6 protein.
          Length = 306

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 84  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 141

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 142 VWKYFVQLCSAVEHMHSRRVMHRDIK 167


>BC114506-1|AAI14507.1|  370|Homo sapiens death-associated protein
           kinase 2 protein.
          Length = 370

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 18/69 (26%), Positives = 37/69 (53%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N I ++  +    + V++++ +   +LF+ L  K  LS +  ++ I+Q+ + +N LH 
Sbjct: 83  HHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHT 142

Query: 28  HNFIHNDIK 2
               H D+K
Sbjct: 143 KKIAHFDLK 151


>BC053536-1|AAH53536.1|  231|Homo sapiens RAGE protein protein.
          Length = 231

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 20/86 (23%), Positives = 50/86 (58%), Gaps = 4/86 (4%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIY---FNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQL 80
           N+ EI+  + +N HPN + ++   F+     +  ++ + +D  +++E ++ +   LS + 
Sbjct: 47  NLREIQALRRLNPHPNILMLHEVVFDRKS-GSLALICELMDM-NIYELIRGRRYPLSEKK 104

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           + + + QLC++L+ +H++   H D+K
Sbjct: 105 IMHYMYQLCKSLDHIHRNGIFHRDVK 130


>BC047696-1|AAH47696.1|  414|Homo sapiens serine/threonine kinase
           17a protein.
          Length = 414

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 20/83 (24%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSN 71
           + EI V +L  D+P  I ++  +   +  ++V++Y    ++F+      E     + V  
Sbjct: 106 IHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQR 165

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           ++RQ+ E ++ LH  + +H D+K
Sbjct: 166 LMRQILEGVHFLHTRDVVHLDLK 188


>BC039825-1|AAH39825.1|  457|Homo sapiens MAK protein protein.
          Length = 457

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 22/83 (26%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL-SHQLVSN 71
           N+ E+K  + +N H N IK+       ++   + +Y+   +L++ ++ + +L    ++ N
Sbjct: 47  NLREVKSLKKLN-HANVIKLKEVIRENDHLYFIFEYMK-ENLYQLMKDRNKLFPESVIRN 104

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I+ Q+ + L  +HKH F H D+K
Sbjct: 105 IMYQILQGLAFIHKHGFFHRDMK 127


>BC023508-1|AAH23508.2|  414|Homo sapiens serine/threonine kinase
           17a protein.
          Length = 414

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 20/83 (24%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE--LSHQLVSN 71
           + EI V +L  D+P  I ++  +   +  ++V++Y    ++F+      E     + V  
Sbjct: 106 IHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQR 165

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           ++RQ+ E ++ LH  + +H D+K
Sbjct: 166 LMRQILEGVHFLHTRDVVHLDLK 188


>BC013879-1|AAH13879.1|  685|Homo sapiens polo-like kinase 2
           (Drosophila) protein.
          Length = 685

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 19/79 (24%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++H++++ H + ++ Y       N  I+++Y     +   L+ +  L+   V   +RQ
Sbjct: 130 EIELHRILH-HKHVVQFYHYFEDKENIYILLEYCSRRSMAHILKARKVLTEPEVRYYLRQ 188

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L  LH+   +H D+K
Sbjct: 189 IVSGLKYLHEQEILHRDLK 207


>BC012761-1|AAH12761.1|  313|Homo sapiens NIMA (never in mitosis
           gene a)-related kinase 6 protein.
          Length = 313

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 91  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 148

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 149 VWKYFVQLCSAVEHMHSRRVMHRDIK 174


>BC004209-1|AAH04209.2|  313|Homo sapiens NEK6 protein protein.
          Length = 313

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 91  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 148

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 149 VWKYFVQLCSAVEHMHSRRVMHRDIK 174


>BC004174-1|AAH04174.2|  313|Homo sapiens NEK6 protein protein.
          Length = 313

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 91  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 148

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 149 VWKYFVQLCSAVEHMHSRRVMHRDIK 174


>BC000101-1|AAH00101.2|  313|Homo sapiens NEK6 protein protein.
          Length = 313

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 91  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 148

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 149 VWKYFVQLCSAVEHMHSRRVMHRDIK 174


>AL162724-9|CAH70254.1|  313|Homo sapiens NIMA (never in mitosis
           gene a)-related kinase 6 protein.
          Length = 313

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 91  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 148

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 149 VWKYFVQLCSAVEHMHSRRVMHRDIK 174


>AL162724-7|CAH70252.1|  222|Homo sapiens NIMA (never in mitosis
           gene a)-related kinase 6 protein.
          Length = 222

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 91  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 148

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 149 VWKYFVQLCSAVEHMHSRRVMHRDIK 174


>AL162724-6|CAH70251.1|  220|Homo sapiens NIMA (never in mitosis
           gene a)-related kinase 6 protein.
          Length = 220

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 91  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 148

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 149 VWKYFVQLCSAVEHMHSRRVMHRDIK 174


>AL162724-5|CAH70250.1|  219|Homo sapiens NIMA (never in mitosis
           gene a)-related kinase 6 protein.
          Length = 219

 Score = 37.9 bits (84), Expect = 0.043
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQI----KGELSHQL 80
           V EI + + +N HPN IK Y +    +N++ IV++  D  DL + ++     K  +  + 
Sbjct: 91  VKEIGLLKQLN-HPNIIK-YLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERT 148

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           V     QLC A+  +H    +H DIK
Sbjct: 149 VWKYFVQLCSAVEHMHSRRVMHRDIK 174


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,541,963
Number of Sequences: 237096
Number of extensions: 2011818
Number of successful extensions: 6917
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 6207
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6856
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10036353240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -