SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC130535-1|AAI30536.1|  867|Homo sapiens C18orf34 protein protein.     31   4.5  
BC091517-1|AAH91517.1|  849|Homo sapiens C18orf34 protein protein.     31   4.5  
AK126038-1|BAC86407.1|  829|Homo sapiens protein ( Homo sapiens ...    31   4.5  

>BC130535-1|AAI30536.1|  867|Homo sapiens C18orf34 protein protein.
          Length = 867

 Score = 31.1 bits (67), Expect = 4.5
 Identities = 19/86 (22%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +2

Query: 269 IKSKVDEQFDQLEREYSDKID--GFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDY 442
           + SK +++   L+  Y  K++    H  +    +E    +C+N  +   +  + +    Y
Sbjct: 273 LDSKQNQELQDLKNHYKKKMEVMDLHRKVNEELEEALE-ACENARLKAQQIKEEIDKDIY 331

Query: 443 TDKKSIETYEK--YCLPQLVDKHNTA 514
            D+K+IE Y++  Y L  L D ++++
Sbjct: 332 QDEKTIEAYKREIYQLNSLFDHYSSS 357


>BC091517-1|AAH91517.1|  849|Homo sapiens C18orf34 protein protein.
          Length = 849

 Score = 31.1 bits (67), Expect = 4.5
 Identities = 19/86 (22%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +2

Query: 269 IKSKVDEQFDQLEREYSDKID--GFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDY 442
           + SK +++   L+  Y  K++    H  +    +E    +C+N  +   +  + +    Y
Sbjct: 273 LDSKQNQELQDLKNHYKKKMEVMDLHRKVNEELEEALE-ACENARLKAQQIKEEIDKDIY 331

Query: 443 TDKKSIETYEK--YCLPQLVDKHNTA 514
            D+K+IE Y++  Y L  L D ++++
Sbjct: 332 QDEKTIEAYKREIYQLNSLFDHYSSS 357


>AK126038-1|BAC86407.1|  829|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44050 fis, clone TESTI4032895. ).
          Length = 829

 Score = 31.1 bits (67), Expect = 4.5
 Identities = 19/86 (22%), Positives = 42/86 (48%), Gaps = 4/86 (4%)
 Frame = +2

Query: 269 IKSKVDEQFDQLEREYSDKID--GFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDY 442
           + SK +++   L+  Y  K++    H  +    +E    +C+N  +   +  + +    Y
Sbjct: 273 LDSKQNQELQDLKNHYKKKMEVMDLHRKVNEELEEALE-ACENARLKAQQIKEEIDKDIY 331

Query: 443 TDKKSIETYEK--YCLPQLVDKHNTA 514
            D+K+IE Y++  Y L  L D ++++
Sbjct: 332 QDEKTIEAYKREIYQLNSLFDHYSSS 357


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,047,663
Number of Sequences: 237096
Number of extensions: 2047036
Number of successful extensions: 12206
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 12022
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12206
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 9127122082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -