SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120039.Seq
         (672 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK097373-1|BAC05026.1|  340|Homo sapiens protein ( Homo sapiens ...    32   2.1  
AY696295-1|AAU10524.1|  292|Homo sapiens cytochrome P450 protein.      31   2.8  
BC036683-1|AAH36683.1|  142|Homo sapiens transmembrane protein 1...    31   5.0  
AY187945-1|AAO38745.1|  188|Homo sapiens transcription factor ML...    31   5.0  
AK095420-1|BAC04545.1|  125|Homo sapiens protein ( Homo sapiens ...    31   5.0  
BC036053-1|AAH36053.1|  955|Homo sapiens KIAA1505 protein protein.     30   6.6  
AY070433-1|AAL65260.1|  255|Homo sapiens hypothetical protein GL...    30   6.6  
AK056542-1|BAB71211.1|  450|Homo sapiens protein ( Homo sapiens ...    30   6.6  
AY187944-1|AAO38744.1|  141|Homo sapiens transcription factor ML...    30   8.7  

>AK097373-1|BAC05026.1|  340|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40054 fis, clone TBAES2000315, weakly similar to
           CYTOCHROME P450 4A1 (EC 1.14.15.3). ).
          Length = 340

 Score = 31.9 bits (69), Expect = 2.1
 Identities = 17/62 (27%), Positives = 28/62 (45%)
 Frame = +3

Query: 57  DKNFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQ 236
           D  FK +   +I +  N  +HQ+ EK+ +   ++   K K     K +Q  LDI+     
Sbjct: 234 DLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRRQDFLDILLSAKS 293

Query: 237 GN 242
            N
Sbjct: 294 EN 295


>AY696295-1|AAU10524.1|  292|Homo sapiens cytochrome P450 protein.
          Length = 292

 Score = 31.5 bits (68), Expect = 2.8
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 57  DKNFKMNLTTEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDII 221
           D  FK +   +I +  N  +HQ+ EK+ +   ++   K K     K +Q  LDI+
Sbjct: 234 DLVFKFSSQGQIFSKFNQELHQFTEKVIQDRKESLKDKLKQDTTQKRRQDFLDIL 288


>BC036683-1|AAH36683.1|  142|Homo sapiens transmembrane protein 188
           protein.
          Length = 142

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = -3

Query: 379 WLIIGATRI*TFSFFLSCWNFP-ICLNCWFLRGIFFARV 266
           WLI   T+    SFF S WN P   ++C  L G+FFA +
Sbjct: 66  WLIDPETQ--KVSFFTSLWNHPFFTISCITLIGLFFAGI 102


>AY187945-1|AAO38745.1|  188|Homo sapiens transcription factor MLL
           UPN95022 protein.
          Length = 188

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 20/90 (22%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +3

Query: 168 KTKAKPRAKNQQT---LLDIIAKFNQGNKAKAKVPV--TRAKKMPLRNQQFKQMGKFQQL 332
           K K KP   N+Q     L+I++  + GN +K K+P       ++  +++QF   G  +++
Sbjct: 34  KEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKDEQFLGFGSDEEV 93

Query: 333 RKKLKVQILVAPMMSHQNRHLSPTKQLKNL 422
           R +   +     M++  ++     K++ +L
Sbjct: 94  RVRSPTRSPSGSMLAQADKLPMTDKRVASL 123


>AK095420-1|BAC04545.1|  125|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38101 fis, clone D3OST1000270. ).
          Length = 125

 Score = 30.7 bits (66), Expect = 5.0
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = -3

Query: 379 WLIIGATRI*TFSFFLSCWNFP-ICLNCWFLRGIFFARV 266
           WLI   T+    SFF S WN P   ++C  L G+FFA +
Sbjct: 49  WLIDPETQ--KVSFFTSLWNHPFFTISCITLIGLFFAGI 85


>BC036053-1|AAH36053.1|  955|Homo sapiens KIAA1505 protein protein.
          Length = 955

 Score = 30.3 bits (65), Expect = 6.6
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +3

Query: 249 KAKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTL 428
           K   P    KKM +  +  +++ K + ++KKL+++ L   + S Q + L   K+L+ L  
Sbjct: 164 KITKPGEMEKKMKILRESTEELRK-EIMQKKLEIKNLREDLASKQKQLLKEQKELEELLG 222

Query: 429 HQLRNKN---HQMTATVMM 476
           HQ+  K+   H  T  V +
Sbjct: 223 HQVVLKDEVAHHQTIPVQI 241


>AY070433-1|AAL65260.1|  255|Homo sapiens hypothetical protein GL002
           protein.
          Length = 255

 Score = 30.3 bits (65), Expect = 6.6
 Identities = 32/138 (23%), Positives = 58/138 (42%), Gaps = 3/138 (2%)
 Frame = +3

Query: 69  KMNLTTEIQADVNSLVHQYLEKIDKSLAQ---TFMKKTKAKPRAKNQQTLLDIIAKFNQG 239
           K   T  +QAD   L H+  +    S+     T +++ +A+P+   Q T   ++AK  Q 
Sbjct: 75  KQKQTIHLQAD--QLQHKLPQMPQLSIRHQKLTPLQQEQAQPKPDVQHTQHPMVAKDRQL 132

Query: 240 NKAKAKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKN 419
               A+ P T  + + ++  Q  Q+ K QQ   + K+ +      S  +   S  KQ  +
Sbjct: 133 PTLMAQPPQTVVQVLAVKTTQ--QLPKLQQAPNQPKIYVQPQTPQSQMSLPASSEKQTAS 190

Query: 420 LTLHQLRNKNHQMTATVM 473
             + Q     H  +  V+
Sbjct: 191 QAIPQYAIPCHSSSNVVV 208


>AK056542-1|BAB71211.1|  450|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31980 fis, clone NT2RP7008487, weakly similar to
           TRICHOHYALIN. ).
          Length = 450

 Score = 30.3 bits (65), Expect = 6.6
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +3

Query: 249 KAKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTL 428
           K   P    KKM +  +  +++ K + ++KKL+++ L   + S Q + L   K+L+ L  
Sbjct: 109 KITKPGEMEKKMKILRESTEELRK-EIMQKKLEIKNLREDLASKQKQLLKEQKELEELLG 167

Query: 429 HQLRNKN---HQMTATVMM 476
           HQ+  K+   H  T  V +
Sbjct: 168 HQVVLKDEVAHHQTIPVQI 186


>AY187944-1|AAO38744.1|  141|Homo sapiens transcription factor MLL
           UPN95022 protein.
          Length = 141

 Score = 29.9 bits (64), Expect = 8.7
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
 Frame = +3

Query: 168 KTKAKPRAKNQQT---LLDIIAKFNQGNKAKAKVPV--TRAKKMPLRNQQFKQMGKFQQL 332
           K K KP   N+Q     L+I++  + GN +K K+P       ++  +++QF   G  +++
Sbjct: 34  KEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKDEQFLGFGSDEEV 93

Query: 333 R 335
           R
Sbjct: 94  R 94


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 74,530,343
Number of Sequences: 237096
Number of extensions: 1179690
Number of successful extensions: 2589
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 2520
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2588
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7647512560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -