SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BX538093-1|CAD98012.1| 1732|Homo sapiens hypothetical protein pr...    31   2.2  
BC037496-1|AAH37496.1|  504|Homo sapiens DYNC2H1 protein protein.      31   2.2  
AK131453-1|BAD18598.1| 1300|Homo sapiens protein ( Homo sapiens ...    31   2.2  
AK095579-1|BAC04578.1|  806|Homo sapiens protein ( Homo sapiens ...    31   2.2  
AK021818-1|BAB13905.1|  553|Homo sapiens protein ( Homo sapiens ...    31   2.2  
AB082528-1|BAC02706.2| 1685|Homo sapiens KIAA1997 protein protein.     31   2.2  
AK126622-1|BAC86616.1| 1060|Homo sapiens protein ( Homo sapiens ...    31   3.0  
AK093802-1|BAC04225.1|  675|Homo sapiens protein ( Homo sapiens ...    31   3.0  

>BX538093-1|CAD98012.1| 1732|Homo sapiens hypothetical protein
            protein.
          Length = 1732

 Score = 31.5 bits (68), Expect = 2.2
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = -3

Query: 271  HAIWSMCWIWSACSNVDLYLPSTWTR 194
            HA++S+ W  +AC     Y+P  WT+
Sbjct: 1287 HALFSLAWFHAACQERRNYIPQGWTK 1312


>BC037496-1|AAH37496.1|  504|Homo sapiens DYNC2H1 protein protein.
          Length = 504

 Score = 31.5 bits (68), Expect = 2.2
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = -3

Query: 271 HAIWSMCWIWSACSNVDLYLPSTWTR 194
           HA++S+ W  +AC     Y+P  WT+
Sbjct: 108 HALFSLAWFHAACQERRNYIPQGWTK 133


>AK131453-1|BAD18598.1| 1300|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16607 fis, clone TESTI4010382, highly  similar
           to Rattus norvegicus dynein, cytoplasmic, heavy chain 2
           (Dnch2). ).
          Length = 1300

 Score = 31.5 bits (68), Expect = 2.2
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = -3

Query: 271 HAIWSMCWIWSACSNVDLYLPSTWTR 194
           HA++S+ W  +AC     Y+P  WT+
Sbjct: 855 HALFSLAWFHAACQERRNYIPQGWTK 880


>AK095579-1|BAC04578.1|  806|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38260 fis, clone FCBBF3001377, highly similar to
           Rattus norvegicus dnchc2 mRNA for cytoplasmic dynein
           heavy ).
          Length = 806

 Score = 31.5 bits (68), Expect = 2.2
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = -3

Query: 271 HAIWSMCWIWSACSNVDLYLPSTWTR 194
           HA++S+ W  +AC     Y+P  WT+
Sbjct: 361 HALFSLAWFHAACQERRNYIPQGWTK 386


>AK021818-1|BAB13905.1|  553|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11756 fis, clone HEMBA1005595, weakly similar to
           DYNEIN HEAVY CHAIN, CYTOSOLIC. ).
          Length = 553

 Score = 31.5 bits (68), Expect = 2.2
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = -3

Query: 271 HAIWSMCWIWSACSNVDLYLPSTWTR 194
           HA++S+ W  +AC     Y+P  WT+
Sbjct: 108 HALFSLAWFHAACQERRNYIPQGWTK 133


>AB082528-1|BAC02706.2| 1685|Homo sapiens KIAA1997 protein protein.
          Length = 1685

 Score = 31.5 bits (68), Expect = 2.2
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = -3

Query: 271  HAIWSMCWIWSACSNVDLYLPSTWTR 194
            HA++S+ W  +AC     Y+P  WT+
Sbjct: 1240 HALFSLAWFHAACQERRNYIPQGWTK 1265


>AK126622-1|BAC86616.1| 1060|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44660 fis, clone BRACE3002344, weakly  similar
           to Vegetatible incompatibility protein HET-E-1. ).
          Length = 1060

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 17/52 (32%), Positives = 22/52 (42%)
 Frame = +1

Query: 280 GRPAVFAPTHSAHYQIWRDSTDNEVQIALRHRITRMAFGGGHSSSAMHGQVR 435
           GR  V    HS   Q W   +     +AL H    +A   G SS+  H Q+R
Sbjct: 665 GRLVVVEDLHSGAQQHWSGHSAEISTLALSHSAQVLASASGRSSTTAHCQIR 716


>AK093802-1|BAC04225.1|  675|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36483 fis, clone THYMU2017601. ).
          Length = 675

 Score = 31.1 bits (67), Expect = 3.0
 Identities = 17/52 (32%), Positives = 22/52 (42%)
 Frame = +1

Query: 280 GRPAVFAPTHSAHYQIWRDSTDNEVQIALRHRITRMAFGGGHSSSAMHGQVR 435
           GR  V    HS   Q W   +     +AL H    +A   G SS+  H Q+R
Sbjct: 278 GRLVVVEDLHSGAQQHWSGHSAEISTLALSHSAQVLASASGRSSTTAHCQIR 329


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 88,905,885
Number of Sequences: 237096
Number of extensions: 2001870
Number of successful extensions: 4156
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 4012
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4156
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6042162242
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -