SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X79981-1|CAA56306.1|  784|Homo sapiens VE-cadherin protein.            33   1.0  
BC117520-1|AAI17521.1|  669|Homo sapiens CDH5 protein protein.         33   1.0  
BC096365-1|AAH96365.1|  662|Homo sapiens CDH5 protein protein.         33   1.0  
BC096364-1|AAH96364.3|  669|Homo sapiens CDH5 protein protein.         33   1.0  
BC096363-1|AAH96363.1|  669|Homo sapiens CDH5 protein protein.         33   1.0  
AB035304-1|BAA87418.1|  784|Homo sapiens cadherin-5 protein.           33   1.0  
X59796-1|CAA42468.1|  780|Homo sapiens cadherin-5 protein.             32   1.8  
U84722-1|AAB41796.1|  784|Homo sapiens vascular endothelial cadh...    32   1.8  
AB209908-1|BAD93145.1|  807|Homo sapiens cadherin 5, type 2 prep...    32   1.8  

>X79981-1|CAA56306.1|  784|Homo sapiens VE-cadherin protein.
          Length = 784

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCKVT-RPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K T    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 507 ITPRNVKFKFTLNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 566

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 567 -GTSTLTVAVCKCNE 580


>BC117520-1|AAI17521.1|  669|Homo sapiens CDH5 protein protein.
          Length = 669

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCKVT-RPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K T    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 392 ITPRNVKFKFTLNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 451

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 452 -GTSTLTVAVCKCNE 465


>BC096365-1|AAH96365.1|  662|Homo sapiens CDH5 protein protein.
          Length = 662

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCKVT-RPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K T    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 385 ITPRNVKFKFTLNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 444

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 445 -GTSTLTVAVCKCNE 458


>BC096364-1|AAH96364.3|  669|Homo sapiens CDH5 protein protein.
          Length = 669

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCKVT-RPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K T    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 392 ITPRNVKFKFTLNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 451

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 452 -GTSTLTVAVCKCNE 465


>BC096363-1|AAH96363.1|  669|Homo sapiens CDH5 protein protein.
          Length = 669

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCKVT-RPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K T    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 392 ITPRNVKFKFTLNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 451

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 452 -GTSTLTVAVCKCNE 465


>AB035304-1|BAA87418.1|  784|Homo sapiens cadherin-5 protein.
          Length = 784

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCKVT-RPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K T    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 507 ITPRNVKFKFTLNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 566

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 567 -GTSTLTVAVCKCNE 580


>X59796-1|CAA42468.1|  780|Homo sapiens cadherin-5 protein.
          Length = 780

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCK-VTRPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K +    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 503 ITPRNVKFKFILNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 562

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 563 -GTSTLTVAVCKCNE 576


>U84722-1|AAB41796.1|  784|Homo sapiens vascular endothelial
           cadherin protein.
          Length = 784

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCK-VTRPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K +    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 507 ITPRNVKFKFILNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 566

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 567 -GTSTLTVAVCKCNE 580


>AB209908-1|BAD93145.1|  807|Homo sapiens cadherin 5, type 2
           preproprotein variant protein.
          Length = 807

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +1

Query: 88  IHPRRANCK-VTRPRNNYSDPDNENDMLHMTVLNSVFLNEHAKLYYRHLLRNDQAEAEKQ 264
           I PR    K +    NN++  DN ++  ++TV    F  EH K+++  ++ +D     + 
Sbjct: 530 ITPRNVKFKFILNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDNGMPSRT 589

Query: 265 FSTPTTCTSAC*LNQ 309
             T T   + C  N+
Sbjct: 590 -GTSTLTVAVCKCNE 603


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 87,038,669
Number of Sequences: 237096
Number of extensions: 1651673
Number of successful extensions: 3979
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3876
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3977
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8399192100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -