SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC130422-1|AAI30423.1| 2210|Homo sapiens mediator complex subuni...    30   9.7  
AY338463-1|AAR08418.1| 2210|Homo sapiens thyroid hormone recepto...    30   9.7  
AL133033-1|CAB61363.1| 1908|Homo sapiens hypothetical protein pr...    30   9.7  
AF515599-1|AAQ08182.1| 2210|Homo sapiens PROSIT240 protein.            30   9.7  
AB028948-1|BAA82977.2| 1917|Homo sapiens KIAA1025 protein protein.     30   9.7  

>BC130422-1|AAI30423.1| 2210|Homo sapiens mediator complex subunit
           13-like protein.
          Length = 2210

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%)
 Frame = -1

Query: 198 EKKAASAVSWRLA---KRSCCICVRRRPQRRCTLAPTRTPT 85
           E+ A++  +W      +R  C C R +  +RC + P R PT
Sbjct: 403 EEPASNPATWDFVDPTQRVSCSCSRHKLLKRCAVGPNRPPT 443


>AY338463-1|AAR08418.1| 2210|Homo sapiens thyroid hormone
           receptor-associated protein complex 240 kDa
           component-like protein.
          Length = 2210

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%)
 Frame = -1

Query: 198 EKKAASAVSWRLA---KRSCCICVRRRPQRRCTLAPTRTPT 85
           E+ A++  +W      +R  C C R +  +RC + P R PT
Sbjct: 403 EEPASNPATWDFVDPTQRVSCSCSRHKLLKRCAVGPNRPPT 443


>AL133033-1|CAB61363.1| 1908|Homo sapiens hypothetical protein
           protein.
          Length = 1908

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%)
 Frame = -1

Query: 198 EKKAASAVSWRLA---KRSCCICVRRRPQRRCTLAPTRTPT 85
           E+ A++  +W      +R  C C R +  +RC + P R PT
Sbjct: 101 EEPASNPATWDFVDPTQRVSCSCSRHKLLKRCAVGPNRPPT 141


>AF515599-1|AAQ08182.1| 2210|Homo sapiens PROSIT240 protein.
          Length = 2210

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%)
 Frame = -1

Query: 198 EKKAASAVSWRLA---KRSCCICVRRRPQRRCTLAPTRTPT 85
           E+ A++  +W      +R  C C R +  +RC + P R PT
Sbjct: 403 EEPASNPATWDFVDPTQRVSCSCSRHKLLKRCAVGPNRPPT 443


>AB028948-1|BAA82977.2| 1917|Homo sapiens KIAA1025 protein protein.
          Length = 1917

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%)
 Frame = -1

Query: 198 EKKAASAVSWRLA---KRSCCICVRRRPQRRCTLAPTRTPT 85
           E+ A++  +W      +R  C C R +  +RC + P R PT
Sbjct: 110 EEPASNPATWDFVDPTQRVSCSCSRHKLLKRCAVGPNRPPT 150


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,593,740
Number of Sequences: 237096
Number of extensions: 2175816
Number of successful extensions: 4527
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 4397
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4522
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8567175942
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -