SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U80759-1|AAB91450.1|  182|Homo sapiens CAGH4 alternate open read...    31   3.1  
U27109-1|AAC52065.1| 1228|Homo sapiens prepromultimerin protein.       31   3.1  
BC063848-1|AAH63848.1| 1228|Homo sapiens multimerin 1 protein.         31   3.1  
AC093759-2|AAY40957.1| 1228|Homo sapiens unknown protein.              31   3.1  
BC036112-1|AAH36112.1|  786|Homo sapiens suppressor of var1, 3-l...    31   4.1  
BC033900-1|AAH33900.1|  335|Homo sapiens NDE1 protein protein.         31   4.1  
BC001421-1|AAH01421.1|  335|Homo sapiens nudE nuclear distributi...    31   4.1  
AL596223-2|CAH71499.1|  786|Homo sapiens suppressor of var1, 3-l...    31   4.1  
AK000108-1|BAA90949.1|  335|Homo sapiens protein ( Homo sapiens ...    31   4.1  

>U80759-1|AAB91450.1|  182|Homo sapiens CAGH4 alternate open reading
           frame protein.
          Length = 182

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 12/23 (52%), Positives = 13/23 (56%)
 Frame = +2

Query: 359 FTSRNPNAISTRWAHCSRPSRGC 427
           FT   P A    W  CSRP+RGC
Sbjct: 60  FTPTQPRAPRPPWTPCSRPTRGC 82


>U27109-1|AAC52065.1| 1228|Homo sapiens prepromultimerin protein.
          Length = 1228

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           +R KIE++   V  LN   ++    H   +N+V  R +  E R+NE    L M     K 
Sbjct: 674 IRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEY--ALEMEDGLNKT 731

Query: 687 KTAI 698
            T I
Sbjct: 732 MTII 735


>BC063848-1|AAH63848.1| 1228|Homo sapiens multimerin 1 protein.
          Length = 1228

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           +R KIE++   V  LN   ++    H   +N+V  R +  E R+NE    L M     K 
Sbjct: 674 IRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEY--ALEMEDGLNKT 731

Query: 687 KTAI 698
            T I
Sbjct: 732 MTII 735


>AC093759-2|AAY40957.1| 1228|Homo sapiens unknown protein.
          Length = 1228

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           +R KIE++   V  LN   ++    H   +N+V  R +  E R+NE    L M     K 
Sbjct: 674 IRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEY--ALEMEDGLNKT 731

Query: 687 KTAI 698
            T I
Sbjct: 732 MTII 735


>BC036112-1|AAH36112.1|  786|Homo sapiens suppressor of var1, 3-like
           1 (S. cerevisiae) protein.
          Length = 786

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 6/84 (7%)
 Frame = +1

Query: 238 RHERKIYNVIDFCKGLEIAHDDILDCNWDSDQVYHLNEIIFHK--QKSKRDLNSLGALFA 411
           RH ++I+ V+D    L    D  +  NW  D      +IIFH     S +  +++   F+
Sbjct: 164 RHAKQIFPVLDCKDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFS 223

Query: 412 TKQGL----LKILMRLNFDNKSNA 471
            K G+    LK+L    F+ KSNA
Sbjct: 224 AKSGVYCGPLKLLAHEIFE-KSNA 246


>BC033900-1|AAH33900.1|  335|Homo sapiens NDE1 protein protein.
          Length = 335

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 6/146 (4%)
 Frame = +3

Query: 270 FLQRS*NCARRHT*LQLGQRSSLPFKRNYFSQAEIQTRSQLV--GRIVRDQAGVVENFDA 443
           + QR+ N        Q G R           Q E + R  L    R+  +   + E F+ 
Sbjct: 25  YKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEV 84

Query: 444 VKF*QQKQRVAAPSN*RRA**LRDKIESVLKHVKKLNTNSEKF----MVTHETFKNDVGN 611
                 +Q  A   +  +   ++D+++  ++ +++ N + E+     +++ E F+  +  
Sbjct: 85  QHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQ 144

Query: 612 RFEQFELRLNELDAKLNMLQSAEKLK 689
             E+     +ELD K N+L+S ++LK
Sbjct: 145 AIERNAFLESELDEKENLLESVQRLK 170


>BC001421-1|AAH01421.1|  335|Homo sapiens nudE nuclear distribution
           gene E homolog 1 (A. nidulans) protein.
          Length = 335

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 6/146 (4%)
 Frame = +3

Query: 270 FLQRS*NCARRHT*LQLGQRSSLPFKRNYFSQAEIQTRSQLV--GRIVRDQAGVVENFDA 443
           + QR+ N        Q G R           Q E + R  L    R+  +   + E F+ 
Sbjct: 25  YKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEV 84

Query: 444 VKF*QQKQRVAAPSN*RRA**LRDKIESVLKHVKKLNTNSEKF----MVTHETFKNDVGN 611
                 +Q  A   +  +   ++D+++  ++ +++ N + E+     +++ E F+  +  
Sbjct: 85  QHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQ 144

Query: 612 RFEQFELRLNELDAKLNMLQSAEKLK 689
             E+     +ELD K N+L+S ++LK
Sbjct: 145 AIERNAFLESELDEKENLLESVQRLK 170


>AL596223-2|CAH71499.1|  786|Homo sapiens suppressor of var1, 3-like
           1 (S. cerevisiae) protein.
          Length = 786

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 6/84 (7%)
 Frame = +1

Query: 238 RHERKIYNVIDFCKGLEIAHDDILDCNWDSDQVYHLNEIIFHK--QKSKRDLNSLGALFA 411
           RH ++I+ V+D    L    D  +  NW  D      +IIFH     S +  +++   F+
Sbjct: 164 RHAKQIFPVLDCKDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFS 223

Query: 412 TKQGL----LKILMRLNFDNKSNA 471
            K G+    LK+L    F+ KSNA
Sbjct: 224 AKSGVYCGPLKLLAHEIFE-KSNA 246


>AK000108-1|BAA90949.1|  335|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20101 fis, clone COL04655. ).
          Length = 335

 Score = 31.1 bits (67), Expect = 4.1
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 6/146 (4%)
 Frame = +3

Query: 270 FLQRS*NCARRHT*LQLGQRSSLPFKRNYFSQAEIQTRSQLV--GRIVRDQAGVVENFDA 443
           + QR+ N        Q G R           Q E + R  L    R+  +   + E F+ 
Sbjct: 25  YKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEV 84

Query: 444 VKF*QQKQRVAAPSN*RRA**LRDKIESVLKHVKKLNTNSEKF----MVTHETFKNDVGN 611
                 +Q  A   +  +   ++D+++  ++ +++ N + E+     +++ E F+  +  
Sbjct: 85  QHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQ 144

Query: 612 RFEQFELRLNELDAKLNMLQSAEKLK 689
             E+     +ELD K N+L+S ++LK
Sbjct: 145 AIERNAFLESELDEKENLLESVQRLK 170


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,495,564
Number of Sequences: 237096
Number of extensions: 1540131
Number of successful extensions: 3377
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3222
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3376
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8455186714
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -