SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC110539-1|AAI10540.1|  870|Homo sapiens sulfatase 2 protein.          31   6.1  
BC090952-1|AAH90952.1|  284|Homo sapiens SULF2 protein protein.        31   6.1  
BC073790-1|AAH73790.1|  206|Homo sapiens SULF2 protein protein.        31   6.1  
AY358461-1|AAQ88826.1|  867|Homo sapiens GPPS559 protein.              31   6.1  
AY101176-1|AAM76861.1|  870|Homo sapiens extracellular sulfatase...    31   6.1  
AL354813-2|CAI17943.1|  870|Homo sapiens RP5-1049G16.1 protein.        31   6.1  
AL034418-7|CAI42143.1|  870|Homo sapiens RP5-1049G16.1 protein.        31   6.1  
AL034418-6|CAI42142.1|  289|Homo sapiens RP5-1049G16.1 protein.        31   6.1  
AB033073-1|BAA86561.2|  885|Homo sapiens KIAA1247 protein protein.     31   6.1  
BC068536-1|AAH68536.1|  345|Homo sapiens KHDRBS3 protein protein.      30   8.0  
BC032606-1|AAH32606.1|  346|Homo sapiens KH domain containing, R...    30   8.0  
AJ506502-1|CAD44735.1|   81|Homo sapiens immunoglobulin kappa li...    30   8.0  
AF069681-1|AAC24857.1|  346|Homo sapiens T-Star protein.               30   8.0  
AF051321-1|AAC99294.1|  346|Homo sapiens Sam68-like phosphotyros...    30   8.0  

>BC110539-1|AAI10540.1|  870|Homo sapiens sulfatase 2 protein.
          Length = 870

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 705 KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 759


>BC090952-1|AAH90952.1|  284|Homo sapiens SULF2 protein protein.
          Length = 284

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 119 KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 173


>BC073790-1|AAH73790.1|  206|Homo sapiens SULF2 protein protein.
          Length = 206

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 59  KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 113


>AY358461-1|AAQ88826.1|  867|Homo sapiens GPPS559 protein.
          Length = 867

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 705 KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 759


>AY101176-1|AAM76861.1|  870|Homo sapiens extracellular sulfatase
           SULF-2 protein.
          Length = 870

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 705 KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 759


>AL354813-2|CAI17943.1|  870|Homo sapiens RP5-1049G16.1 protein.
          Length = 870

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 705 KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 759


>AL034418-7|CAI42143.1|  870|Homo sapiens RP5-1049G16.1 protein.
          Length = 870

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 705 KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 759


>AL034418-6|CAI42142.1|  289|Homo sapiens RP5-1049G16.1 protein.
          Length = 289

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 124 KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 178


>AB033073-1|BAA86561.2|  885|Homo sapiens KIAA1247 protein protein.
          Length = 885

 Score = 30.7 bits (66), Expect = 6.1
 Identities = 15/55 (27%), Positives = 20/55 (36%)
 Frame = -1

Query: 471 KSLKLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTTLGTASEHWC 307
           K L+ L  R Q       P   C+ + N  W      TL   C  T    + +WC
Sbjct: 720 KKLRKLLKRLQNNDTCSMPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWC 774


>BC068536-1|AAH68536.1|  345|Homo sapiens KHDRBS3 protein protein.
          Length = 345

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +3

Query: 339 FDNGYSEFCDKQQPNDYLNYYNNPTPDGAD 428
           +D+GY    D+Q  + Y N Y+ P   GAD
Sbjct: 270 YDDGYGTAYDEQSYDSYDNSYSTPAQSGAD 299


>BC032606-1|AAH32606.1|  346|Homo sapiens KH domain containing, RNA
           binding, signal transduction associated 3 protein.
          Length = 346

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +3

Query: 339 FDNGYSEFCDKQQPNDYLNYYNNPTPDGAD 428
           +D+GY    D+Q  + Y N Y+ P   GAD
Sbjct: 271 YDDGYGTAYDEQSYDSYDNSYSTPAQSGAD 300


>AJ506502-1|CAD44735.1|   81|Homo sapiens immunoglobulin kappa light
           chain variable region protein.
          Length = 81

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 3/39 (7%)
 Frame = +3

Query: 294 FNASYTSAPTPSRASFDNGYSEF---CDKQQPNDYLNYY 401
           F ASY  A  PSR S     +EF       QP+D+  YY
Sbjct: 32  FKASYLEAGVPSRFSASGSATEFTLTISSLQPDDFATYY 70


>AF069681-1|AAC24857.1|  346|Homo sapiens T-Star protein.
          Length = 346

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +3

Query: 339 FDNGYSEFCDKQQPNDYLNYYNNPTPDGAD 428
           +D+GY    D+Q  + Y N Y+ P   GAD
Sbjct: 271 YDDGYGTAYDEQSYDSYDNSYSTPAQSGAD 300


>AF051321-1|AAC99294.1|  346|Homo sapiens Sam68-like phosphotyrosine
           protein alpha protein.
          Length = 346

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +3

Query: 339 FDNGYSEFCDKQQPNDYLNYYNNPTPDGAD 428
           +D+GY    D+Q  + Y N Y+ P   GAD
Sbjct: 271 YDDGYGTAYDEQSYDSYDNSYSTPAQSGAD 300


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,191,508
Number of Sequences: 237096
Number of extensions: 2278085
Number of successful extensions: 5131
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 4905
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5131
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9367263024
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -