SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC041089-1|AAH41089.1| 1390|Homo sapiens polymerase (RNA) III (D...    31   4.2  
AY091459-1|AAM12029.1|  374|Homo sapiens RNA polymerase III subu...    31   4.2  
AL512628-1|CAI16466.1| 1390|Homo sapiens polymerase (RNA) III (D...    31   4.2  
AF021351-1|AAB86536.1| 1391|Homo sapiens RNA polymerase III larg...    31   4.2  
BC016048-1|AAH16048.1|  317|Homo sapiens LRRC38 protein protein.       30   7.4  
AL603749-2|CAH70436.1|  294|Homo sapiens leucine rich repeat con...    30   7.4  
AL354712-1|CAI21926.1|  294|Homo sapiens leucine rich repeat con...    30   7.4  

>BC041089-1|AAH41089.1| 1390|Homo sapiens polymerase (RNA) III (DNA
           directed) polypeptide A, 155kDa protein.
          Length = 1390

 Score = 31.1 bits (67), Expect = 4.2
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)
 Frame = +2

Query: 11  ITDKCSKRKVCLH---HKRIARLLGIKKIYHQEY---KRVVSKVYKN 133
           I+DKC K+ +C H        +  G+ KI H++Y   K+VV  +  N
Sbjct: 146 ISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSN 192


>AY091459-1|AAM12029.1|  374|Homo sapiens RNA polymerase III subunit
           RPC155-A protein.
          Length = 374

 Score = 31.1 bits (67), Expect = 4.2
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)
 Frame = +2

Query: 11  ITDKCSKRKVCLH---HKRIARLLGIKKIYHQEY---KRVVSKVYKN 133
           I+DKC K+ +C H        +  G+ KI H++Y   K+VV  +  N
Sbjct: 146 ISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSN 192


>AL512628-1|CAI16466.1| 1390|Homo sapiens polymerase (RNA) III (DNA
           directed) (155kD) (RPC155) protein.
          Length = 1390

 Score = 31.1 bits (67), Expect = 4.2
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)
 Frame = +2

Query: 11  ITDKCSKRKVCLH---HKRIARLLGIKKIYHQEY---KRVVSKVYKN 133
           I+DKC K+ +C H        +  G+ KI H++Y   K+VV  +  N
Sbjct: 146 ISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSN 192


>AF021351-1|AAB86536.1| 1391|Homo sapiens RNA polymerase III largest
           subunit protein.
          Length = 1391

 Score = 31.1 bits (67), Expect = 4.2
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%)
 Frame = +2

Query: 11  ITDKCSKRKVCLH---HKRIARLLGIKKIYHQEY---KRVVSKVYKN 133
           I+DKC K+ +C H        +  G+ KI H++Y   K+VV  +  N
Sbjct: 146 ISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSN 192


>BC016048-1|AAH16048.1|  317|Homo sapiens LRRC38 protein protein.
          Length = 317

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = -1

Query: 651 SLSRISQLSFNSAKFALVSTAVCLFLLAGIA 559
           SL  +S+ SF+  +F+L  T +C+ + +G+A
Sbjct: 250 SLRELSEASFSECRFSLSLTDLCIIIFSGVA 280


>AL603749-2|CAH70436.1|  294|Homo sapiens leucine rich repeat
           containing 38 protein.
          Length = 294

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = -1

Query: 651 SLSRISQLSFNSAKFALVSTAVCLFLLAGIA 559
           SL  +S+ SF+  +F+L  T +C+ + +G+A
Sbjct: 227 SLRELSEASFSECRFSLSLTDLCIIIFSGVA 257


>AL354712-1|CAI21926.1|  294|Homo sapiens leucine rich repeat
           containing 38 protein.
          Length = 294

 Score = 30.3 bits (65), Expect = 7.4
 Identities = 11/31 (35%), Positives = 21/31 (67%)
 Frame = -1

Query: 651 SLSRISQLSFNSAKFALVSTAVCLFLLAGIA 559
           SL  +S+ SF+  +F+L  T +C+ + +G+A
Sbjct: 227 SLRELSEASFSECRFSLSLTDLCIIIFSGVA 257


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 105,723,342
Number of Sequences: 237096
Number of extensions: 2284464
Number of successful extensions: 4648
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 4471
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4648
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8623170556
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -