SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT007059-1|AAP35708.1|  282|Homo sapiens esterase 10 protein.         120   8e-27
BC001169-1|AAH01169.1|  282|Homo sapiens esterase D/formylglutat...   120   8e-27
AL136958-4|CAI12228.1|  282|Homo sapiens esterase D/formylglutat...   120   8e-27
AL136958-2|CAI12226.1|  253|Homo sapiens esterase D/formylglutat...   120   8e-27
AF112219-1|AAC99788.1|  282|Homo sapiens esterase D protein.          120   8e-27
AL136958-1|CAI12225.1|  229|Homo sapiens esterase D/formylglutat...   119   1e-26
M13450-1|AAA52408.1|  297|Homo sapiens ESD protein.                   108   2e-23
AF052509-1|AAC06298.1|   33|Homo sapiens esterase D protein.           63   9e-10
BC111413-1|AAI11414.1|  393|Homo sapiens MESP2 protein protein.        30   8.0  

>BT007059-1|AAP35708.1|  282|Homo sapiens esterase 10 protein.
          Length = 282

 Score =  120 bits (288), Expect = 8e-27
 Identities = 54/104 (51%), Positives = 69/104 (66%)
 Frame = +1

Query: 178 EFFYLSPPSGRRG*CEITTSILFVWSTCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGV 357
           +F    PP    G C     +  +  TC+EQNFI+KSG+ + A+EHG++V+ PDTSPRG 
Sbjct: 31  KFAVYLPPKAETGKCPALYWLSGL--TCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGC 88

Query: 358 KIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
            I G+D SWDFG  AGFY+DAT +PW  NYRM SY+  EL  LI
Sbjct: 89  NIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLI 132



 Score =  108 bits (260), Expect = 2e-23
 Identities = 49/85 (57%), Positives = 57/85 (67%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VDP R            AL+  L+NPG+YKSVSAFA ICNP  CPWG KAFSGYLG D+S
Sbjct: 138 VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 197

Query: 690 KWAEWDATELVKKYNGPPLTLLLDR 764
           KW  +DAT LVK Y G  L +L+D+
Sbjct: 198 KWKAYDATHLVKSYPGSQLDILIDQ 222



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/54 (61%), Positives = 40/54 (74%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L+  SSNK FGG QKV+ H S EL CKM F++YLPP+AE G  K P LY+LSG
Sbjct: 2   ALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETG--KCPALYWLSG 53


>BC001169-1|AAH01169.1|  282|Homo sapiens esterase
           D/formylglutathione hydrolase protein.
          Length = 282

 Score =  120 bits (288), Expect = 8e-27
 Identities = 54/104 (51%), Positives = 69/104 (66%)
 Frame = +1

Query: 178 EFFYLSPPSGRRG*CEITTSILFVWSTCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGV 357
           +F    PP    G C     +  +  TC+EQNFI+KSG+ + A+EHG++V+ PDTSPRG 
Sbjct: 31  KFAVYLPPKAETGKCPALYWLSGL--TCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGC 88

Query: 358 KIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
            I G+D SWDFG  AGFY+DAT +PW  NYRM SY+  EL  LI
Sbjct: 89  NIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLI 132



 Score =  108 bits (260), Expect = 2e-23
 Identities = 49/85 (57%), Positives = 57/85 (67%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VDP R            AL+  L+NPG+YKSVSAFA ICNP  CPWG KAFSGYLG D+S
Sbjct: 138 VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 197

Query: 690 KWAEWDATELVKKYNGPPLTLLLDR 764
           KW  +DAT LVK Y G  L +L+D+
Sbjct: 198 KWKAYDATHLVKSYPGSQLDILIDQ 222



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/54 (61%), Positives = 40/54 (74%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L+  SSNK FGG QKV+ H S EL CKM F++YLPP+AE G  K P LY+LSG
Sbjct: 2   ALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETG--KCPALYWLSG 53


>AL136958-4|CAI12228.1|  282|Homo sapiens esterase
           D/formylglutathione hydrolase protein.
          Length = 282

 Score =  120 bits (288), Expect = 8e-27
 Identities = 54/104 (51%), Positives = 69/104 (66%)
 Frame = +1

Query: 178 EFFYLSPPSGRRG*CEITTSILFVWSTCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGV 357
           +F    PP    G C     +  +  TC+EQNFI+KSG+ + A+EHG++V+ PDTSPRG 
Sbjct: 31  KFAVYLPPKAETGKCPALYWLSGL--TCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGC 88

Query: 358 KIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
            I G+D SWDFG  AGFY+DAT +PW  NYRM SY+  EL  LI
Sbjct: 89  NIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLI 132



 Score =  108 bits (260), Expect = 2e-23
 Identities = 49/85 (57%), Positives = 57/85 (67%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VDP R            AL+  L+NPG+YKSVSAFA ICNP  CPWG KAFSGYLG D+S
Sbjct: 138 VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 197

Query: 690 KWAEWDATELVKKYNGPPLTLLLDR 764
           KW  +DAT LVK Y G  L +L+D+
Sbjct: 198 KWKAYDATHLVKSYPGSQLDILIDQ 222



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/54 (61%), Positives = 40/54 (74%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L+  SSNK FGG QKV+ H S EL CKM F++YLPP+AE G  K P LY+LSG
Sbjct: 2   ALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETG--KCPALYWLSG 53


>AL136958-2|CAI12226.1|  253|Homo sapiens esterase
           D/formylglutathione hydrolase protein.
          Length = 253

 Score =  120 bits (288), Expect = 8e-27
 Identities = 54/104 (51%), Positives = 69/104 (66%)
 Frame = +1

Query: 178 EFFYLSPPSGRRG*CEITTSILFVWSTCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGV 357
           +F    PP    G C     +  +  TC+EQNFI+KSG+ + A+EHG++V+ PDTSPRG 
Sbjct: 2   KFAVYLPPKAETGKCPALYWLSGL--TCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGC 59

Query: 358 KIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
            I G+D SWDFG  AGFY+DAT +PW  NYRM SY+  EL  LI
Sbjct: 60  NIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLI 103



 Score =  108 bits (260), Expect = 2e-23
 Identities = 49/85 (57%), Positives = 57/85 (67%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VDP R            AL+  L+NPG+YKSVSAFA ICNP  CPWG KAFSGYLG D+S
Sbjct: 109 VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 168

Query: 690 KWAEWDATELVKKYNGPPLTLLLDR 764
           KW  +DAT LVK Y G  L +L+D+
Sbjct: 169 KWKAYDATHLVKSYPGSQLDILIDQ 193



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 16/26 (61%), Positives = 20/26 (76%)
 Frame = +2

Query: 176 MNFSIYLPPQAEGGDVKLPLLYYLSG 253
           M F++YLPP+AE G  K P LY+LSG
Sbjct: 1   MKFAVYLPPKAETG--KCPALYWLSG 24


>AF112219-1|AAC99788.1|  282|Homo sapiens esterase D protein.
          Length = 282

 Score =  120 bits (288), Expect = 8e-27
 Identities = 54/104 (51%), Positives = 69/104 (66%)
 Frame = +1

Query: 178 EFFYLSPPSGRRG*CEITTSILFVWSTCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGV 357
           +F    PP    G C     +  +  TC+EQNFI+KSG+ + A+EHG++V+ PDTSPRG 
Sbjct: 31  KFAVYLPPKAETGKCPALYWLSGL--TCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGC 88

Query: 358 KIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
            I G+D SWDFG  AGFY+DAT +PW  NYRM SY+  EL  LI
Sbjct: 89  NIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLI 132



 Score =  108 bits (260), Expect = 2e-23
 Identities = 49/85 (57%), Positives = 57/85 (67%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VDP R            AL+  L+NPG+YKSVSAFA ICNP  CPWG KAFSGYLG D+S
Sbjct: 138 VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 197

Query: 690 KWAEWDATELVKKYNGPPLTLLLDR 764
           KW  +DAT LVK Y G  L +L+D+
Sbjct: 198 KWKAYDATHLVKSYPGSQLDILIDQ 222



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 33/54 (61%), Positives = 40/54 (74%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L+  SSNK FGG QKV+ H S EL CKM F++YLPP+AE G  K P LY+LSG
Sbjct: 2   ALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETG--KCPALYWLSG 53


>AL136958-1|CAI12225.1|  229|Homo sapiens esterase
           D/formylglutathione hydrolase protein.
          Length = 229

 Score =  119 bits (286), Expect = 1e-26
 Identities = 49/78 (62%), Positives = 61/78 (78%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPW 435
           TC+EQNFI+KSG+ + A+EHG++V+ PDTSPRG  I G+D SWDFG  AGFY+DAT +PW
Sbjct: 2   TCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPW 61

Query: 436 NNNYRMGSYLNVELYDLI 489
             NYRM SY+  EL  LI
Sbjct: 62  KTNYRMYSYVTEELPQLI 79



 Score =  108 bits (260), Expect = 2e-23
 Identities = 49/85 (57%), Positives = 57/85 (67%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VDP R            AL+  L+NPG+YKSVSAFA ICNP  CPWG KAFSGYLG D+S
Sbjct: 85  VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 144

Query: 690 KWAEWDATELVKKYNGPPLTLLLDR 764
           KW  +DAT LVK Y G  L +L+D+
Sbjct: 145 KWKAYDATHLVKSYPGSQLDILIDQ 169


>M13450-1|AAA52408.1|  297|Homo sapiens ESD protein.
          Length = 297

 Score =  108 bits (260), Expect = 2e-23
 Identities = 49/85 (57%), Positives = 57/85 (67%)
 Frame = +3

Query: 510 VDPNRXXXXXXXXXXXXALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKS 689
           VDP R            AL+  L+NPG+YKSVSAFA ICNP  CPWG KAFSGYLG D+S
Sbjct: 153 VDPQRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQS 212

Query: 690 KWAEWDATELVKKYNGPPLTLLLDR 764
           KW  +DAT LVK Y G  L +L+D+
Sbjct: 213 KWKAYDATHLVKSYPGSQLDILIDQ 237



 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 28/49 (57%), Positives = 32/49 (65%)
 Frame = +1

Query: 343 SPRGVKIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
           SPR   I G+D SWDF    GFY+DAT +PW  NYRM SY+  EL  LI
Sbjct: 99  SPRACNIKGEDESWDFATGRGFYVDATEDPWKTNYRMYSYVTEELPQLI 147



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/42 (61%), Positives = 32/42 (76%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGG 217
           +L+  SSNK FGG QKV+ H S EL CKM F++YLPP+AE G
Sbjct: 16  ALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETG 57


>AF052509-1|AAC06298.1|   33|Homo sapiens esterase D protein.
          Length = 33

 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 26/32 (81%), Positives = 27/32 (84%)
 Frame = +3

Query: 600 SVSAFAAICNPSACPWGVKAFSGYLGEDKSKW 695
           SVSAFA ICNP  CPWG KAFSGYLG D+SKW
Sbjct: 1   SVSAFAPICNPVLCPWGKKAFSGYLGTDQSKW 32


>BC111413-1|AAI11414.1|  393|Homo sapiens MESP2 protein protein.
          Length = 393

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 19/55 (34%), Positives = 23/55 (41%)
 Frame = +3

Query: 579 RNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGPP 743
           R PG   +V A A+  +PSACP G +A    LG        W       K   PP
Sbjct: 202 RRPGLVSAVLAEASWGSPSACP-GAQAAPERLGRGVHDTDPWATPPYCPKIQSPP 255


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,822,255
Number of Sequences: 237096
Number of extensions: 2648133
Number of successful extensions: 4775
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 4562
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4773
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9311505506
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -