SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120020.Seq
         (726 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U32519-1|AAB07787.1|  466|Homo sapiens GAP SH3 binding protein p...    30   9.7  
CR536535-1|CAG38772.1|  466|Homo sapiens G3BP protein.                 30   9.7  
BT019384-1|AAV38191.1|  466|Homo sapiens Ras-GTPase-activating p...    30   9.7  
BC108278-1|AAI08279.1|  466|Homo sapiens GTPase activating prote...    30   9.7  
BC006997-1|AAH06997.1|  466|Homo sapiens GTPase activating prote...    30   9.7  
AK222606-1|BAD96326.1|  466|Homo sapiens Ras-GTPase-activating p...    30   9.7  

>U32519-1|AAB07787.1|  466|Homo sapiens GAP SH3 binding protein
           protein.
          Length = 466

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 200 WAIVQTTKIE*SAAISITGHPAGTCHVPAA*DYQKGFSLRKV-G*KPQQVQTI--QRINC 370
           WA V +  +  S A+ +TG P     VPA+    +     ++   +PQ+ Q +  QRIN 
Sbjct: 251 WASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINI 310

Query: 371 APIRSRRRICE 403
            P R  R I E
Sbjct: 311 PPQRGPRPIRE 321


>CR536535-1|CAG38772.1|  466|Homo sapiens G3BP protein.
          Length = 466

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 200 WAIVQTTKIE*SAAISITGHPAGTCHVPAA*DYQKGFSLRKV-G*KPQQVQTI--QRINC 370
           WA V +  +  S A+ +TG P     VPA+    +     ++   +PQ+ Q +  QRIN 
Sbjct: 251 WASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINI 310

Query: 371 APIRSRRRICE 403
            P R  R I E
Sbjct: 311 PPQRGPRPIRE 321


>BT019384-1|AAV38191.1|  466|Homo sapiens Ras-GTPase-activating
           protein SH3-domain-binding protein protein.
          Length = 466

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 200 WAIVQTTKIE*SAAISITGHPAGTCHVPAA*DYQKGFSLRKV-G*KPQQVQTI--QRINC 370
           WA V +  +  S A+ +TG P     VPA+    +     ++   +PQ+ Q +  QRIN 
Sbjct: 251 WASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINI 310

Query: 371 APIRSRRRICE 403
            P R  R I E
Sbjct: 311 PPQRGPRPIRE 321


>BC108278-1|AAI08279.1|  466|Homo sapiens GTPase activating protein
           (SH3 domain) binding protein 1 protein.
          Length = 466

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 200 WAIVQTTKIE*SAAISITGHPAGTCHVPAA*DYQKGFSLRKV-G*KPQQVQTI--QRINC 370
           WA V +  +  S A+ +TG P     VPA+    +     ++   +PQ+ Q +  QRIN 
Sbjct: 251 WASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINI 310

Query: 371 APIRSRRRICE 403
            P R  R I E
Sbjct: 311 PPQRGPRPIRE 321


>BC006997-1|AAH06997.1|  466|Homo sapiens GTPase activating protein
           (SH3 domain) binding protein 1 protein.
          Length = 466

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 200 WAIVQTTKIE*SAAISITGHPAGTCHVPAA*DYQKGFSLRKV-G*KPQQVQTI--QRINC 370
           WA V +  +  S A+ +TG P     VPA+    +     ++   +PQ+ Q +  QRIN 
Sbjct: 251 WASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINI 310

Query: 371 APIRSRRRICE 403
            P R  R I E
Sbjct: 311 PPQRGPRPIRE 321


>AK222606-1|BAD96326.1|  466|Homo sapiens Ras-GTPase-activating
           protein SH3-domain-binding protein variant protein.
          Length = 466

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 3/71 (4%)
 Frame = +2

Query: 200 WAIVQTTKIE*SAAISITGHPAGTCHVPAA*DYQKGFSLRKV-G*KPQQVQTI--QRINC 370
           WA V +  +  S A+ +TG P     VPA+    +     ++   +PQ+ Q +  QRIN 
Sbjct: 251 WASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINI 310

Query: 371 APIRSRRRICE 403
            P R  R I E
Sbjct: 311 PPQRGPRPIRE 321


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 95,611,283
Number of Sequences: 237096
Number of extensions: 1927167
Number of successful extensions: 3785
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 3716
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3785
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8567175942
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -